3AAF: WRN RQC domain

Structure of WRN RQC domain bound to double-stranded DNA. Determined by X-ray diffraction at 1.9 Å resolution. Released 16 Feb 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,690
Mol. weight: 39.38 kDa
Released: 16 Feb 2010

Explore 3AAF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AAF contains 10 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	957-958	2	1
α-helix	960-972	13
α-helix	980-986	7
α-helix	996-1000	5
α-helix	1012-1024	13
β-strand	1028-1032	5	2
β-strand	1039-1043	5	2
α-helix	1045-1054	10
β-strand	1062-1063	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Werner syndrome ATP-dependent helicase	A, B	protein	134	Homo sapiens	Q14191 (AlphaFold model)
DNA (5'-d(apcpcpcptpapaptptpapgpgpgpt)-3')	C, D	DNA	14

Sequence of entity 1 (A, B), FASTA

>3AAF_1 Werner syndrome ATP-dependent helicase (chains A, B)
GIRMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFG
TGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQA
NEELCPKKFLLPSS

Sequence of entity 2 (C, D), FASTA

>3AAF_2 DNA (5'-D(*AP*CP*CP*CP*TP*AP*AP*TP*TP*AP*GP*GP*GP*T)-3') (chains C, D)
ACCCTAATTAGGGT

Primary citation

Structural basis for DNA strand separation by the unconventional winged-helix domain of RecQ helicase WRN. Kitano, K., Kim, S.Y., Hakoshima, T. Structure (2010) 18:177-187. DOI 10.1016/j.str.2009.12.011 · PubMed

Other PDB entries of the same protein (UniProt Q14191 (AlphaFold model), which also has an AlphaFold model), best resolution first:

10AK 1.37 Å, Crystal Structure of Human WRN helicase with compound 4
7GQU 1.54 Å, Crystal Structure of Werner helicase fragment 517-945 in covalent complex with…
9OWB 1.56 Å, Human WRN helicase in complex with allosteric ligand Compound 6
7GQS 1.57 Å, Crystal Structure of Werner helicase fragment 517-945 in complex with ADP
9MJU 1.58 Å, Crystal structure of WRN helicase with allosteric fragment 1
7XUT 1.6 Å, Crystal structure of RPA70N-WRN fusion
8PFP 1.6 Å, Crystal structure of WRN helicase domain in complex with ATPgammaS
9MJY 1.63 Å, Crystal structure of WRN helicase with bound allosteric compound 1
9OG8 1.66 Å, Crystal structure of WRN in complex with compound 43
9OWC 1.67 Å, Human WRN helicase in complex with allosteric ligand Compound 7
9MJZ 1.7 Å, Crystal structure of WRN helicase with bound allosteric compound 3
9MJT 1.73 Å, Crystal structure of apo WRN helicase in Form D

Browse structure collections

About this viewer

MolViewer shows 3AAF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.