Crystal Structure of Yeast Rpn14, a Chaperone of the 19S Regulatory Particle of the Proteasome. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Mar 2010.
Explore 3ACP in 3D Show helices and sheets RCSB PDB PDBe
3ACP contains 1 α-helix and 38 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| β-strand | 8-10 | 3 | 2 |
| α-helix | 14-18 | 5 | |
| β-strand | 26-33 | 8 | 2 |
| β-strand | 39-46 | 8 | 2 |
| β-strand | 53-54 | 2 | 2 |
| β-strand | 60-65 | 6 | 3 |
| β-strand | 68-73 | 6 | 3 |
| β-strand | 76-81 | 6 | 3 |
| β-strand | 83-86 | 4 | 4 |
| β-strand | 96-103 | 8 | 5 |
| β-strand | 107-113 | 7 | 5 |
| β-strand | 118-122 | 5 | 5 |
| β-strand | 127-131 | 5 | 5 |
| β-strand | 139-144 | 6 | 6 |
| β-strand | 150-155 | 6 | 6 |
| β-strand | 160-164 | 5 | 6 |
| β-strand | 172-174 | 3 | 6 |
| β-strand | 181-187 | 7 | 7 |
| β-strand | 192-197 | 6 | 7 |
| β-strand | 202-206 | 5 | 7 |
| β-strand | 211-216 | 6 | 7 |
| β-strand | 226-233 | 8 | 8 |
| β-strand | 257-263 | 7 | 8 |
| β-strand | 268-272 | 5 | 8 |
| β-strand | 278-282 | 5 | 8 |
| β-strand | 290-295 | 6 | 1 |
| β-strand | 302-307 | 6 | 1 |
| β-strand | 311-316 | 6 | 1 |
| β-strand | 325-328 | 4 | 1 |
| β-strand | 335-341 | 7 | 3 |
| β-strand | 344-349 | 6 | 3 |
| β-strand | 353-358 | 6 | 3 |
| β-strand | 359-361 | 3 | 9 |
| β-strand | 368-370 | 3 | 9 |
| β-strand | 376-378 | 3 | 3 |
| β-strand | 385-391 | 7 | 4 |
| β-strand | 399-404 | 6 | 4 |
| β-strand | 408-413 | 6 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| WD repeat-containing protein YGL004C | A | protein | 417 | Saccharomyces cerevisiae | P53196 (AlphaFold model) |
>3ACP_1 WD repeat-containing protein YGL004C (chains A) MTKTITVAHIQYDFKAVLEENDENDDEFYINVDKNLNEIKEHKIVVLGNSRGVDAGKGNT FEKVGSHLYKARLDGHDFLFNTIIRDGSKMLKRADYTAVDTAKLQMRRFILGTTEGDIKV LDSNFNLQREIDQAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRAT VTDIAIIDRGRNVLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNSIALFVGTDRQLH EISTSKKNNLEFGTYGKYVIAGHVSGVITVHNVFSKEQTIQLPSKFTCSCNSLTVDGNNA NYIYAGYENGMLAQWDLRSPECPVGEFLINEGTPINNVYFAAGALFVSSGFDTSIKLDII SDPESERPAIEFETPTFLVSNDDEVSQFCYVSDDESNGEVLEVGKNNFCALYNLSNP
Crystal structure of yeast Rpn14, a chaperone of the 19S regulatory particle of the proteasome. Kim, S., Saeki, Y., Fukunaga, K. et al. J Biol Chem (2010) 285:15159-15166. DOI 10.1074/jbc.M110.104042 · PubMed
Other PDB entries of the same protein (UniProt P53196 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ACP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.