3AG0: Carbonmonoxy human cytoglobin

Crystal structure of carbonmonoxy human cytoglobin. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 Feb 2011.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,352
Mol. weight: 22.22 kDa
Ligands: HEM, CMO
Released: 2 Feb 2011

Explore 3AG0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AG0 contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	21-35	15
α-helix	38-52	15
α-helix	57-59	3
α-helix	69-74	6
α-helix	76-94	19
α-helix	99-111	13
α-helix	112-116	5
α-helix	122-138	17
α-helix	145-168	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoglobin	A	protein	192	Homo sapiens	Q8WWM9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AG0_1 Cytoglobin (chains A)
GSMEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQ
YFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHK
VEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNA
TTPPATLPSSGP

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1
CMO	Carbon monoxide	C O	1

Primary citation

Crystal structure of the carbon monoxide complex of human cytoglobin. Makino, M., Sawai, H., Shiro, Y. et al. Proteins (2011) 79:1143-1153. DOI 10.1002/prot.22950 · PubMed

Other PDB entries of the same protein (UniProt Q8WWM9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DC3 1.68 Å, Crystal structure of human cytoglobin at 1.68 angstroms resolution
1URV 2.0 Å, Crystal structure of cytoglobin: the fourth globin type discovered in man displays heme…
1UT0 2.1 Å, Crystal structure of cytoglobin: the fourth globin type discovered in man displays heme…
1URY 2.4 Å, cytoglobin cavities
1UX9 2.4 Å, Mapping protein matrix cavities in human cytoglobin through Xe atom binding: a…
1V5H 2.4 Å, Crystal Structure of Human Cytoglobin (Ferric Form)
1UMO 2.59 Å, The crystal structure of cytoglobin: the fourth globin type discovered in man
4B3W 2.8 Å, Crystal structure of human cytoglobin H(E7)Q mutant

Browse structure collections

About this viewer

MolViewer shows 3AG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.