4B3W: Human cytoglobin H(E7)Q mutant

Crystal structure of human cytoglobin H(E7)Q mutant. Determined by X-ray diffraction at 2.8 Å resolution. Released 23 Jan 2013.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,610
Mol. weight: 44.55 kDa
Ligands: FC6, CYN, HEM
Released: 23 Jan 2013

Explore 4B3W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B3W contains 20 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	21-34	14
α-helix	35-37	3
α-helix	38-52	15
α-helix	54-59	6
α-helix	69-74	6
α-helix	76-94	19
α-helix	99-115	17
α-helix	123-138	16
α-helix	140-142	3
α-helix	145-169	25

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	21-34	14
α-helix	35-37	3
α-helix	38-52	15
α-helix	54-58	5
α-helix	69-74	6
α-helix	76-93	18
α-helix	99-115	17
α-helix	123-138	16
α-helix	140-142	3
α-helix	145-169	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytoglobin	A, B	protein	190	HOMO SAPIENS	Q8WWM9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4B3W_1 CYTOGLOBIN (chains A, B)
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKQASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP

Ligands and cofactors

ID	Name	Formula	Copies
FC6	HEXACYANOFERRATE(3-)	C6 Fe N6	2
CYN	Cyanide ion	C N	2
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	2

Water and common crystallization additives (ACT) are not listed.

Primary citation

Co Rebinding Kinetics and Molecular Dynamics Simulations Highlight Dynamic Regulation of Internal Cavities in Human Cytoglobin. Gabba, M., Abbruzzetti, S., Spyrakis, F. et al. PLoS One (2013) 8:49770. DOI 10.1371/JOURNAL.PONE.0049770 · PubMed

Other PDB entries of the same protein (UniProt Q8WWM9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DC3 1.68 Å, Crystal structure of human cytoglobin at 1.68 angstroms resolution
1URV 2.0 Å, Crystal structure of cytoglobin: the fourth globin type discovered in man displays heme…
1UT0 2.1 Å, Crystal structure of cytoglobin: the fourth globin type discovered in man displays heme…
1URY 2.4 Å, cytoglobin cavities
1UX9 2.4 Å, Mapping protein matrix cavities in human cytoglobin through Xe atom binding: a…
1V5H 2.4 Å, Crystal Structure of Human Cytoglobin (Ferric Form)
1UMO 2.59 Å, The crystal structure of cytoglobin: the fourth globin type discovered in man
3AG0 2.6 Å, Crystal structure of carbonmonoxy human cytoglobin

Browse structure collections

About this viewer

MolViewer shows 4B3W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.