Crystal structure of carbonmonoxy human cytoglobin. Determined by X-ray diffraction at 2.6 Å resolution. Released 2 Feb 2011.
Explore 3AG0 in 3D Show helices and sheets RCSB PDB PDBe
3AG0 contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-35 | 15 | |
| α-helix | 38-52 | 15 | |
| α-helix | 57-59 | 3 | |
| α-helix | 69-74 | 6 | |
| α-helix | 76-94 | 19 | |
| α-helix | 99-111 | 13 | |
| α-helix | 112-116 | 5 | |
| α-helix | 122-138 | 17 | |
| α-helix | 145-168 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoglobin | A | protein | 192 | Homo sapiens | Q8WWM9 (AlphaFold model) |
>3AG0_1 Cytoglobin (chains A) GSMEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQ YFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHK VEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNA TTPPATLPSSGP
Crystal structure of the carbon monoxide complex of human cytoglobin. Makino, M., Sawai, H., Shiro, Y. et al. Proteins (2011) 79:1143-1153. DOI 10.1002/prot.22950 · PubMed
Other PDB entries of the same protein (UniProt Q8WWM9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3AG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.