3AGX: Human Hsp40 Hdj1 peptide-binding domain

Crystal structure of human Hsp40 Hdj1 peptide-binding domain. Determined by X-ray diffraction at 1.85 Å resolution. Released 23 Feb 2011.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,831
Mol. weight: 40.96 kDa
Released: 23 Feb 2011

Explore 3AGX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AGX contains 18 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	166-170	5	1
α-helix	172-177	6
β-strand	179-190	12	2
β-strand	197-208	12	2
α-helix	209	1
α-helix	212-213	2
β-strand	217-220	4	1
α-helix	231-234	4
β-strand	235-241	7	1
α-helix	242-243	2
β-strand	248-250	3	3
β-strand	253-261	9	3
α-helix	262-267	6
β-strand	269-274	6	4
β-strand	280-285	6	4
α-helix	289-290	2
β-strand	294-297	4	3
α-helix	302	1
β-strand	303	1	5
α-helix	304	1
β-strand	311	1	5
β-strand	314-321	8	3
α-helix	322-323	2
α-helix	328-337	10

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	166-170	5	6
α-helix	172-177	6
β-strand	179-182	4	7
β-strand	205-208	4	7
β-strand	217-219	3	6
β-strand	236-241	6	6
α-helix	242-243	2
β-strand	248-250	3	8
β-strand	253-261	9	8
α-helix	262-267	6
β-strand	269-274	6	9
β-strand	280-285	6	9
α-helix	288-290	3
β-strand	294-297	4	8
α-helix	302	1
β-strand	303	1	10
α-helix	304	1
β-strand	311	1	10
β-strand	314-321	8	8
α-helix	328-337	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DnaJ homolog subfamily B member 1	A, B	protein	181	Homo sapiens	P25685 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3AGX_1 DnaJ homolog subfamily B member 1 (chains A, B)
MDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKIT
FPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGR
TIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLP
I

Primary citation

Peptide-binding sites as revealed by the crystal structures of the human Hsp40 Hdj1 C-terminal domain in complex with the octapeptide from human Hsp70. Suzuki, H., Noguchi, S., Arakawa, H. et al. Biochemistry (2010) 49:8577-8584. DOI 10.1021/bi100876n · PubMed

Other PDB entries of the same protein (UniProt P25685 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
4WB7 1.9 Å, Crystal structure of a chimeric fusion of human DnaJ (Hsp40) and cAMP-dependent protein…
8FE2 2.34 Å, Structure of J-PKAc chimera complexed with Aplithianine A
9NFS 2.45 Å, Structure of J-PKAc chimera in complex with Aplithianine j1
3AGZ 2.51 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
8FE5 2.51 Å, Structure of J-PKAc chimera complexed with Aplithianine B
7NDX 2.54 Å, Crystal structure of the human HSP40 DNAJB1-CTDs in complex with a peptide of NudC
2QLD 2.7 Å, human Hsp40 Hdj1
8FEC 2.7 Å, Structure of J-PKAc chimera complexed with Aplithianine derivative
6BYR 3.66 Å, Structures of the PKA RI alpha holoenzyme with the FLHCC driver J-PKAc alpha or native…
6WJG 6.2 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma
6WJF 7.5 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma

Browse structure collections

About this viewer

MolViewer shows 3AGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.