Crystal Structure of TopBP1 BRCT7/8-BACH1 peptide complex. Determined by X-ray diffraction at 2.15 Å resolution. Released 1 Dec 2010.
Explore 3AL3 in 3D Show helices and sheets RCSB PDB PDBe
3AL3 contains 14 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1269-1273 | 5 | 1 |
| α-helix | 1277-1289 | 13 | |
| β-strand | 1293-1294 | 2 | 1 |
| β-strand | 1306-1309 | 4 | 1 |
| α-helix | 1316-1323 | 8 | |
| β-strand | 1327-1329 | 3 | 1 |
| α-helix | 1332-1340 | 9 | |
| α-helix | 1347-1349 | 3 | |
| β-strand | 1350 | 1 | 1 |
| α-helix | 1354-1357 | 4 | |
| α-helix | 1365-1385 | 21 | |
| β-strand | 1398-1402 | 5 | 2 |
| α-helix | 1408-1417 | 10 | |
| β-strand | 1421-1422 | 2 | 2 |
| α-helix | 1428-1430 | 3 | |
| β-strand | 1436-1439 | 4 | 2 |
| α-helix | 1453-1458 | 6 | |
| β-strand | 1462-1465 | 4 | 2 |
| α-helix | 1467-1474 | 8 | |
| α-helix | 1478-1480 | 3 | |
| α-helix | 1481-1484 | 4 | |
| β-strand | 1485 | 1 | 2 |
| α-helix | 1487-1489 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1133-1135 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA topoisomerase 2-binding protein 1 | A | protein | 235 | Homo sapiens | Q92547 (AlphaFold model) |
| Peptide of Fanconi anemia group J protein | B | protein | 10 | Q9BX63 (AlphaFold model) |
>3AL3_1 DNA topoisomerase 2-binding protein 1 (chains A) GPLGSLKKQYIFQLSSLNPQERIDYCHLIEKLGGLVIEKQCFDPTCTHIVVGHPLRNEKY LASVAAGKWVLHRSYLEACRTAGHFVQEEDYEWGSSSILDVLTGINVQQRRLALAAMRWR KKIQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVLPGHSVPLFKEATHLF SDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFI
>3AL3_2 Peptide of Fanconi anemia group J protein (chains B) SIYFTPELYD
Molecular basis of BACH1/FANCJ recognition by TopBP1 in DNA replication checkpoint control. Leung, C.C., Gong, Z., Chen, J. et al. J Biol Chem (2011) 286:4292-4301. DOI 10.1074/jbc.M110.189555 · PubMed
Other PDB entries of the same protein (UniProt Q92547 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3AL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.