5B22: Dimer structure of murine Nectin-3 D1D2

Dimer structure of murine Nectin-3 D1D2. Determined by X-ray diffraction at 2.58 Å resolution. Released 28 Dec 2016.

Method: X-ray diffraction
Resolution: 2.58 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,522
Mol. weight: 47.43 kDa
Released: 28 Dec 2016

Explore 5B22 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5B22 contains 7 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	7-11	5	2
β-strand	16-18	3	3
β-strand	21-22	2	1
β-strand	27-37	11	2
β-strand	40-48	9	2
β-strand	52-55	4	2
α-helix	57-59	3
β-strand	63-65	3	3
β-strand	72	1	1
β-strand	75-77	3	3
α-helix	82-84	3
β-strand	86-95	10	2
β-strand	98-109	12	2
β-strand	110	1	4
α-helix	111-112	2
β-strand	113-117	5	5
β-strand	130-140	11	5
β-strand	141	1	4
β-strand	145-149	5	6
β-strand	154-161	8	5
β-strand	167-175	9	5
α-helix	179-181	3
β-strand	185-191	7	6
β-strand	199-204	6	6

Chain B: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	7
β-strand	7-11	5	8
β-strand	16-18	3	9
β-strand	21-22	2	7
β-strand	27-37	11	8
β-strand	40-48	9	8
β-strand	52-55	4	8
α-helix	57-59	3
β-strand	63-65	3	9
β-strand	72	1	7
β-strand	75-77	3	9
α-helix	82-84	3
β-strand	86-95	10	8
β-strand	98-109	12	8
β-strand	110	1	10
β-strand	113-118	6	11
β-strand	123-124	2	12
α-helix	127-129	3
β-strand	130-140	11	11
β-strand	141	1	10
β-strand	145-149	5	13
β-strand	154-161	8	11
β-strand	167-175	9	11
β-strand	185-191	7	13
β-strand	199-204	6	13
β-strand	207-208	2	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nectin-3	A, B	protein	211	Mus musculus	Q9JLB9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5B22_1 Nectin-3 (chains A, B)
PSIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSTQTVAVHHPQYGFSVQGDY
QGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKG
PDSLIDGGNETVAAVCVAATGKPVAQIDWEGDLGEMESSTTSFPNETATIVSQYKLFPTR
FARGRRITCVVKHPALEKDIRYSFILDIQHH

Primary citation

Dimer structure of murine Nectin-3 D1D2. Sangawa, T., Takebe, K., Katsutani, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q9JLB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AXA 2.78 Å, Crystal structure of afadin PDZ domain in complex with the C-terminal peptide from…

Browse structure collections

About this viewer

MolViewer shows 5B22 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.