Crystal structure of human Hsp70 NBD in the ADP-, Mg ion-, and K ion-bound state. Determined by X-ray diffraction at 1.75 Å resolution. Released 28 Dec 2011.
Explore 3AY9 in 3D Show helices and sheets RCSB PDB PDBe
3AY9 contains 17 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-10 | 4 | 1 |
| β-strand | 15-16 | 2 | 2 |
| β-strand | 17-22 | 6 | 1 |
| β-strand | 25-28 | 4 | 1 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 2 |
| β-strand | 42-44 | 3 | 3 |
| β-strand | 49-51 | 3 | 3 |
| α-helix | 53-57 | 5 | |
| α-helix | 63-65 | 3 | |
| β-strand | 66-67 | 2 | 3 |
| α-helix | 70-72 | 3 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 4 |
| β-strand | 100-107 | 8 | 4 |
| β-strand | 110-114 | 5 | 4 |
| α-helix | 116-135 | 20 | |
| β-strand | 141-146 | 6 | 1 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 1 |
| α-helix | 175-182 | 8 | |
| β-strand | 193-200 | 8 | 5 |
| β-strand | 205-213 | 9 | 5 |
| β-strand | 216-225 | 10 | 5 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-274 | 18 | |
| β-strand | 279-288 | 10 | 6 |
| β-strand | 291-298 | 8 | 6 |
| α-helix | 299-311 | 13 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 5 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| β-strand | 360 | 1 | 5 |
| α-helix | 365-367 | 3 | |
| α-helix | 368-381 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock 70 kDa protein 1A/1B | A | protein | 392 | Homo sapiens | P0DMV8 (AlphaFold model) |
>3AY9_1 Heat shock 70 kDa protein 1A/1B (chains A) GSFTMAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAK NQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYP EEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP TAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNR LVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTS ITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNG RDLNKSINPDEAVAYGAAVQAAILMGDKSENV
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
| MG | Magnesium ion | Mg | 1 |
| PO4 | Phosphate ion | O4 P | 1 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
Water and common crystallization additives (CL, K) are not listed.
Biochemical and structural studies on the high affinity of Hsp70 for ADP. Arakawa, A., Handa, N., Shirouzu, M. et al. Protein Sci (2011) 20:1367-1379. DOI 10.1002/pro.663 · PubMed
Other PDB entries of the same protein (UniProt P0DMV8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3AY9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.