3B2F: Maize Ferredoxin 1

Maize Ferredoxin 1. Determined by X-ray diffraction at 1.7 Å resolution. Released 13 Jun 2012.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Zea mays
Chains: 2
Atoms: 1,594
Mol. weight: 21.39 kDa
Ligands: FES
Released: 13 Jun 2012

Explore 3B2F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3B2F contains 8 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	1
β-strand	12-19	8	1
α-helix	24-30	7
β-strand	48-53	6	1
β-strand	56-57	2	2
β-strand	59	1	3
β-strand	61	1	3
α-helix	66-70	5
β-strand	73-75	3	1
α-helix	76-78	3
β-strand	80-81	2	2
β-strand	85-88	4	1
α-helix	92-95	4

Chain B: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	4
β-strand	12-19	8	4
α-helix	24-30	7
β-strand	48-53	6	4
β-strand	56-57	2	5
α-helix	66-70	5
β-strand	73-75	3	4
α-helix	76-78	3
β-strand	80-81	2	5
β-strand	85-88	4	4
α-helix	92-95	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferredoxin-1, chloroplastic	A, B	protein	98	Zea mays	P27787 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3B2F_1 Ferredoxin-1, chloroplastic (chains A, B)
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSD
QSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA

Ligands and cofactors

ID	Name	Formula	Copies
FES	FE2/S2 (inorganic) cluster	Fe2 S2	2

Primary citation

A new structural insight into differential interaction of cyanobacterial and plant ferredoxins with nitrite reductase as revealed by NMR and X-ray crystallographic studies. Sakakibara, Y., Kimura, H., Iwamura, A. et al. J Biochem (2012) 151:483-492. DOI 10.1093/jb/mvs028 · PubMed

Other PDB entries of the same protein (UniProt P27787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5H92 2.08 Å, Crystal structure of the complex between maize Sulfite Reductase and ferredoxin in the…
5H8Y 2.2 Å, Crystal structure of the complex between maize sulfite reductase and ferredoxin in the…
1GAQ 2.59 Å, Crystal structure of the complex between ferredoxin and ferredoxin-NADP+ reductase
3W5U 2.7 Å, Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase
3W5V 3.81 Å, Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase

Browse structure collections

About this viewer

MolViewer shows 3B2F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.