Crystal Structure of Calcium-Saturated Calmodulin N-Terminal Domain Fragment, Residues 1-75. Determined by X-ray diffraction at 1.6 Å resolution. Released 13 Nov 2007.
Explore 3B32 in 3D Show helices and sheets RCSB PDB PDBe
3B32 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-19 | 14 | |
| β-strand | 27 | 1 | 1 |
| α-helix | 29-38 | 10 | |
| α-helix | 45-53 | 9 | |
| β-strand | 63 | 1 | 1 |
| α-helix | 65-73 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Calmodulin | A | protein | 75 | Rattus norvegicus | P0DP29 (AlphaFold model) |
>3B32_1 Calmodulin (chains A) ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN GTIDFPEFLTMMARK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Thermodynamics and conformational change governing domain-domain interactions of calmodulin. O'Donnell, S.E., Newman, R.A., Witt, T.J. et al. Methods Enzymol (2009) 466:503-526. DOI 10.1016/S0076-6879(09)66021-3 · PubMed
Other PDB entries of the same protein (UniProt P0DP29 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3B32 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.