3B6E: PDB entry 3B6E

Crystal structure of human DECH-box RNA Helicase MDA5 (Melanoma differentiation-associated protein 5), DECH-domain. Determined by X-ray diffraction at 1.6 Å resolution. Released 13 Nov 2007.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,664
Mol. weight: 24.13 kDa
Released: 13 Nov 2007

Explore 3B6E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3B6E contains 11 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	293-299	7
α-helix	310-320	11
β-strand	325-328	4	1
α-helix	332-352	21
β-strand	359-363	5	1
α-helix	366-372	7
α-helix	373-377	5
α-helix	378-381	4
β-strand	387-389	3	1
α-helix	400-406	7
β-strand	409-413	5	1
α-helix	414-422	9
α-helix	434-436	3
β-strand	439-442	4	1
α-helix	454-473	20
α-helix	477-480	4
β-strand	483-488	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-induced helicase C domain-containing protein 1	A	protein	216	Homo sapiens	Q9BYX4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3B6E_1 Interferon-induced helicase C domain-containing protein 1 (chains A)
SMNSNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSG
KTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDT
QLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVY
NNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS

Primary citation

Human DECH-box RNA Helicase MDA5 (Melanoma differentiation-associated protein 5), DECH-domain. Karlberg, T., Welin, M., Arrowsmith, C.H. et al. To be published.

Other PDB entries of the same protein (UniProt Q9BYX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GA3 1.45 Å, Crystal structure of the C-terminal domain of human MDA5
9Y4J 2.81 Å, CryoEM Structure of human MDA5 with dsRNA (one protein subunit on dsRNA)
9Y4L 2.96 Å, CryoEM Structure of human MDA5 in complex with dsRNA (two protein subunits on dsRNA)
9LOV 3.07 Å, LGP2:MDA5:dsRNA filament
9Q60 3.12 Å, CryoEM Structure of human MDA5 disease-linked mutant T331I with dsRNA (one protein…
7DNI 3.2 Å, MDA5 CARDs-MAVS CARD polyUb complex
9Q5W 3.21 Å, CryoEM Structure of human MDA5 T331I mutant in complex with dsRNA
7DNJ 3.3 Å, K63-polyUb MDA5CARDs complex
4GL2 3.56 Å, Structural Basis for dsRNA duplex backbone recognition by MDA5
7JL0 4.3 Å, Cryo-EM structure of MDA5-dsRNA in complex with TRIM65 PSpry domain (Monomer)
7JL2 4.3 Å, Cryo-EM structure of MDA5-dsRNA filament in complex with TRIM65 PSpry domain (Trimer)
2RQB Solution structure of MDA5 CTD

Browse structure collections

About this viewer

MolViewer shows 3B6E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.