3GA3: C-terminal domain of human MDA5

Crystal structure of the C-terminal domain of human MDA5. Determined by X-ray diffraction at 1.45 Å resolution. Released 24 Feb 2009.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,296
Mol. weight: 15.65 kDa
Ligands: ZN
Released: 24 Feb 2009

Explore 3GA3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GA3 contains 8 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	897	1	1
α-helix	900-902	3
β-strand	903-907	5	2
β-strand	913-916	4	2
α-helix	917-919	3
β-strand	921-923	3	3
β-strand	927-929	3	3
α-helix	934-937	4
β-strand	939-942	4	3
β-strand	949-950	2	3
β-strand	955-962	8	3
β-strand	967-974	8	3
β-strand	977-982	6	3
α-helix	983	1
α-helix	984-986	3
β-strand	987-991	5	2
β-strand	996-998	3	2
α-helix	1003-1005	3
β-strand	1008	1	1
β-strand	1012-1013	2	3
α-helix	1015-1017	3
α-helix	1018-1024	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-induced helicase C domain-containing protein 1, MDA5	A	protein	133	Homo sapiens	Q9BYX4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GA3_1 Interferon-induced helicase C domain-containing protein 1, MDA5 (chains A)
AKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCA
DYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPN
LDYSELEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Crystal structure of the C-terminal domain of human MDA5. Li, P., Li, X., Lu, C. To be published.

Other PDB entries of the same protein (UniProt Q9BYX4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3B6E 1.6 Å, Crystal structure of human DECH-box RNA Helicase MDA5 (Melanoma…
9Y4J 2.81 Å, CryoEM Structure of human MDA5 with dsRNA (one protein subunit on dsRNA)
9Y4L 2.96 Å, CryoEM Structure of human MDA5 in complex with dsRNA (two protein subunits on dsRNA)
9LOV 3.07 Å, LGP2:MDA5:dsRNA filament
9Q60 3.12 Å, CryoEM Structure of human MDA5 disease-linked mutant T331I with dsRNA (one protein…
7DNI 3.2 Å, MDA5 CARDs-MAVS CARD polyUb complex
9Q5W 3.21 Å, CryoEM Structure of human MDA5 T331I mutant in complex with dsRNA
7DNJ 3.3 Å, K63-polyUb MDA5CARDs complex
4GL2 3.56 Å, Structural Basis for dsRNA duplex backbone recognition by MDA5
7JL0 4.3 Å, Cryo-EM structure of MDA5-dsRNA in complex with TRIM65 PSpry domain (Monomer)
7JL2 4.3 Å, Cryo-EM structure of MDA5-dsRNA filament in complex with TRIM65 PSpry domain (Trimer)
2RQB Solution structure of MDA5 CTD

Browse structure collections

About this viewer

MolViewer shows 3GA3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.