3B7O: PDB entry 3B7O

Crystal structure of the human tyrosine phosphatase SHP2 (PTPN11) with an accessible active site. Determined by X-ray diffraction at 1.6 Å resolution. Released 13 Nov 2007.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,465
Mol. weight: 37.01 kDa
Ligands: MLT
Released: 13 Nov 2007

Explore 3B7O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3B7O contains 13 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	247-258	12
α-helix	259-262	4
α-helix	267-269	3
α-helix	271-276	6
β-strand	289-291	3	1
α-helix	292-293	2
β-strand	304-310	7	1
β-strand	327-331	5	1
α-helix	332-334	3
α-helix	338-347	10
β-strand	352-355	4	1
β-strand	360-361	2	2
β-strand	364-365	2	2
α-helix	372-373	2
β-strand	377-380	4	1
β-strand	383-392	10	1
β-strand	396-405	10	1
β-strand	408-420	13	1
α-helix	433-447	15
α-helix	454	1
β-strand	455-459	5	1
α-helix	464-482	19
α-helix	490-498	9
α-helix	508-527	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 11	A	protein	316	Homo sapiens	Q06124 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3B7O_1 Tyrosine-protein phosphatase non-receptor type 11 (chains A)
MHHHHHHSSGVDLGTENLYFQSMAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQEN
KNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGC
LQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAA
HDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAG
PVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRF
IYMAVQHYIETLQRRI

Ligands and cofactors

ID	Name	Formula	Copies
MLT	D-malate	C4 H6 O5	1

Primary citation

Large-scale structural analysis of the classical human protein tyrosine phosphatome. Barr, A.J., Ugochukwu, E., Lee, W.H. et al. Cell (2009) 136:352-363. DOI 10.1016/j.cell.2008.11.038 · PubMed

Other PDB entries of the same protein (UniProt Q06124 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EIK 1.25 Å, Crystal structure of N-SH2 domain of SHP2 with T42A mutation bound to GAB1 tyrosine…
3ZM1 1.4 Å, Catalytic domain of human SHP2
4JMG 1.4 Å, Crystal structure of the synthetic protein in complex with pY peptide
7PPM 1.48 Å, SHP2 catalytic domain in complex with IRS1 (889-901) phosphopeptide (pSer-892, pTyr-896)
3ZM0 1.5 Å, Catalytic domain of human SHP2
3ZM2 1.5 Å, Catalytic domain of human SHP2
3ZM3 1.5 Å, Catalytic domain of human SHP2
7PPL 1.53 Å, SHP2 catalytic domain in complex with IRS1 (625-639) phosphopeptide (pTyr-632, pSer-636)
9EIC 1.58 Å, Crystal structure of unbound N-SH2 domain of SHP2 with T42A mutation
9EHD 1.59 Å, Crystal structure of N-SH2 domain of SHP2 bound to GAB1 tyrosine phosphorylated peptide…
4RDD 1.6 Å, Co-crystal structure of SHP2 in complex with a Cefsulodin derivative
5EHR 1.7 Å, Non-receptor Protein Tyrosine Phosphatase SHP2 in Complex with Allosteric Inhibitor SHP099

Browse structure collections

About this viewer

MolViewer shows 3B7O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.