Crystal structure of Factor XIa in complex with Clavatadine A. Determined by X-ray diffraction at 1.6 Å resolution. Released 9 Dec 2008.
Explore 3BG8 in 3D Show helices and sheets RCSB PDB PDBe
3BG8 contains 12 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 371 | 1 | 1 |
| β-strand | 374-375 | 2 | 2 |
| α-helix | 376-377 | 2 | |
| β-strand | 384-389 | 6 | 3 |
| β-strand | 395-404 | 10 | 3 |
| β-strand | 407-410 | 4 | 3 |
| α-helix | 412-415 | 4 | |
| α-helix | 421-423 | 3 | |
| β-strand | 424-427 | 4 | 3 |
| β-strand | 432 | 1 | 4 |
| α-helix | 433-435 | 3 | |
| β-strand | 443-450 | 8 | 3 |
| α-helix | 457-459 | 3 | |
| β-strand | 464-468 | 5 | 3 |
| β-strand | 475 | 1 | 5 |
| β-strand | 478 | 1 | 5 |
| α-helix | 480-481 | 2 | |
| β-strand | 482 | 1 | 2 |
| α-helix | 483-485 | 3 | |
| α-helix | 486-489 | 4 | |
| β-strand | 496-500 | 5 | 2 |
| β-strand | 513 | 1 | 4 |
| α-helix | 514 | 1 | |
| β-strand | 515-518 | 4 | 2 |
| β-strand | 521-522 | 2 | 2 |
| α-helix | 524-530 | 7 | |
| β-strand | 540-543 | 4 | 2 |
| β-strand | 551 | 1 | 1 |
| β-strand | 560-565 | 6 | 2 |
| β-strand | 568-577 | 10 | 2 |
| β-strand | 588-592 | 5 | 2 |
| α-helix | 593-596 | 4 | |
| α-helix | 597-604 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor XIa light chain | A | protein | 238 | Homo sapiens | P03951 (AlphaFold model) |
>3BG8_1 Coagulation factor XIa light chain (chains A) IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSG ILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPISLPSKGER NVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGG KDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV
Water and common crystallization additives (SO4) are not listed.
Clavatadine A, a natural product with selective recognition and irreversible inhibition of factor XIa. Buchanan, M.S., Carroll, A.R., Wessling, D. et al. J Med Chem (2008) 51:3583-3587. DOI 10.1021/jm800314b · PubMed
Other PDB entries of the same protein (UniProt P03951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3BG8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.