Coagulation factor XI protease domain in complex with active site inhibitor 2. Determined by X-ray diffraction at 1.25 Å resolution. Released 13 Sept 2023.
Explore 8BO6 in 3D Show helices and sheets RCSB PDB PDBe
8BO6 contains 9 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 389 | 1 | 1 |
| β-strand | 392-393 | 2 | 2 |
| β-strand | 402-407 | 6 | 3 |
| β-strand | 413-422 | 10 | 3 |
| β-strand | 425-428 | 4 | 3 |
| α-helix | 430-433 | 4 | |
| α-helix | 439-441 | 3 | |
| β-strand | 442-446 | 5 | 3 |
| β-strand | 450 | 1 | 4 |
| α-helix | 451-453 | 3 | |
| β-strand | 461 | 1 | 3 |
| β-strand | 463-468 | 6 | 3 |
| α-helix | 475-477 | 3 | |
| β-strand | 482-486 | 5 | 3 |
| α-helix | 489-492 | 4 | |
| β-strand | 493 | 1 | 5 |
| β-strand | 496 | 1 | 5 |
| β-strand | 500 | 1 | 2 |
| α-helix | 501-503 | 3 | |
| β-strand | 514-518 | 5 | 2 |
| β-strand | 531 | 1 | 4 |
| β-strand | 533-536 | 4 | 2 |
| β-strand | 539-540 | 2 | 2 |
| α-helix | 542-548 | 7 | |
| β-strand | 558-561 | 4 | 2 |
| β-strand | 569 | 1 | 1 |
| β-strand | 578-583 | 6 | 2 |
| β-strand | 586-595 | 10 | 2 |
| β-strand | 606-610 | 5 | 2 |
| α-helix | 611-614 | 4 | |
| α-helix | 615-623 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor XIa light chain | AAA | protein | 238 | Homo sapiens | P03951 (AlphaFold model) |
>8BO6_1 Coagulation factor XIa light chain (chains AAA) IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSG ILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPISLPSKGDR NVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGG KDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| CIT | Citric acid | C6 H8 O7 | 1 |
| QW0 | (~{E})-~{N}-[[5-(3-azanyl-1~{H}-indazol-6-yl)-4-chloranyl-1~{H}-imidazol-2-yl]m… | C21 H16 Cl2 N10 O | 1 |
Water and common crystallization additives (GOL) are not listed.
Design and Preclinical Characterization Program toward Asundexian (BAY 2433334), an Oral Factor XIa Inhibitor for the Prevention and Treatment of Thromboembolic Disorders. Roehrig, S., Ackerstaff, J., Jimenez Nunez, E. et al. J Med Chem (2023) 66:12203-12224. DOI 10.1021/acs.jmedchem.3c00795 · PubMed
Other PDB entries of the same protein (UniProt P03951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8BO6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.