Factor XIa in Complex with Compound 2e. Determined by X-ray diffraction at 1.47 Å resolution. Released 3 Aug 2022.
Explore 7V11 in 3D Show helices and sheets RCSB PDB PDBe
7V11 contains 9 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 389 | 1 | 1 |
| β-strand | 392-393 | 2 | 2 |
| β-strand | 402-407 | 6 | 3 |
| β-strand | 413-422 | 10 | 3 |
| β-strand | 425-428 | 4 | 3 |
| α-helix | 430-433 | 4 | |
| α-helix | 439-441 | 3 | |
| β-strand | 442-445 | 4 | 3 |
| β-strand | 450 | 1 | 4 |
| α-helix | 451-453 | 3 | |
| β-strand | 461 | 1 | 3 |
| β-strand | 463-468 | 6 | 3 |
| α-helix | 475-477 | 3 | |
| β-strand | 482-486 | 5 | 3 |
| α-helix | 489-492 | 4 | |
| β-strand | 493 | 1 | 5 |
| β-strand | 496 | 1 | 5 |
| β-strand | 500 | 1 | 2 |
| α-helix | 501-503 | 3 | |
| β-strand | 514-518 | 5 | 2 |
| β-strand | 531 | 1 | 4 |
| β-strand | 533-536 | 4 | 2 |
| β-strand | 539-540 | 2 | 2 |
| α-helix | 542-548 | 7 | |
| β-strand | 558-561 | 4 | 2 |
| β-strand | 569 | 1 | 1 |
| β-strand | 578-583 | 6 | 2 |
| β-strand | 586-595 | 10 | 2 |
| β-strand | 606-610 | 5 | 2 |
| α-helix | 611-614 | 4 | |
| α-helix | 615-622 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor XIa light chain | A | protein | 238 | Homo sapiens | P03951 (AlphaFold model) |
>7V11_1 Coagulation factor XIa light chain (chains A) IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSG ILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPISLPSKGDR NVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGG KDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| OQO | 5-[1-[(1~{R})-1-[5-[3-chloranyl-2-fluoranyl-6-(1,2,3,4-tetrazol-1-yl)phenyl]-1-… | C26 H23 Cl F N9 O | 1 |
| CIT | Citric acid | C6 H8 O7 | 1 |
Discovery of Potent and Orally Bioavailable Pyridine N-Oxide-Based Factor XIa Inhibitors through Exploiting Nonclassical Interactions. Xu, G., Liu, Z., Wang, X. et al. J Med Chem (2022) 65:10419-10440. DOI 10.1021/acs.jmedchem.2c00442 · PubMed
Other PDB entries of the same protein (UniProt P03951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7V11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.