Crystal Structure of the 25kDa Subunit of Human Cleavage factor Im with Ap4A. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Feb 2008.
Explore 3BHO in 3D Show helices and sheets RCSB PDB PDBe
3BHO contains 9 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 24-30 | 7 | |
| β-strand | 36-39 | 4 | 1 |
| β-strand | 41 | 1 | 2 |
| α-helix | 42-44 | 3 | |
| β-strand | 45-50 | 6 | 3 |
| α-helix | 60-74 | 15 | |
| β-strand | 77-84 | 8 | 4 |
| β-strand | 85-88 | 4 | 2 |
| β-strand | 91-100 | 10 | 2 |
| β-strand | 103-105 | 3 | 2 |
| β-strand | 108-110 | 3 | 4 |
| α-helix | 111-112 | 2 | |
| α-helix | 117-129 | 13 | |
| β-strand | 140-150 | 11 | 4 |
| β-strand | 158 | 1 | 4 |
| β-strand | 170-178 | 9 | 4 |
| α-helix | 179-180 | 2 | |
| β-strand | 183-188 | 6 | 3 |
| β-strand | 192-197 | 6 | 2 |
| α-helix | 198-201 | 4 | |
| α-helix | 205-212 | 8 | |
| α-helix | 215-219 | 5 | |
| β-strand | 223-226 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cleavage and polyadenylation specificity factor subunit 5 | A | protein | 208 | Homo sapiens | O43809 (AlphaFold model) |
>3BHO_1 Cleavage and polyadenylation specificity factor subunit 5 (chains A) FGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRT VEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDW VIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLF ELYDNAPGYGPIISSLPQLLSRFNFIYN
| ID | Name | Formula | Copies |
|---|---|---|---|
| B4P | Bis(adenosine)-5'-tetraphosphate | C20 H28 N10 O19 P4 | 1 |
Crystal structure of the 25 kDa subunit of human cleavage factor Im. Coseno, M., Martin, G., Berger, C. et al. Nucleic Acids Res (2008) 36:3474-3483. DOI 10.1093/nar/gkn079 · PubMed
Other PDB entries of the same protein (UniProt O43809 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3BHO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.