PanDDA analysis group deposition -- Crystal Structure of HUMAN CLEAVAGE FACTOR IM in complex with EN08775-42. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Jul 2020.
Explore 5R4R in 3D Show helices and sheets RCSB PDB PDBe
5R4R contains 18 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 35 | 1 | |
| β-strand | 36-39 | 4 | 1 |
| β-strand | 41 | 1 | 2 |
| α-helix | 42-44 | 3 | |
| β-strand | 45-50 | 6 | 3 |
| α-helix | 60-74 | 15 | |
| β-strand | 77-84 | 8 | 4 |
| β-strand | 85-88 | 4 | 2 |
| β-strand | 91-99 | 9 | 2 |
| β-strand | 104-105 | 2 | 2 |
| β-strand | 108-110 | 3 | 4 |
| α-helix | 111-112 | 2 | |
| α-helix | 117-129 | 13 | |
| α-helix | 135-137 | 3 | |
| β-strand | 140-150 | 11 | 4 |
| β-strand | 158 | 1 | 4 |
| α-helix | 161-162 | 2 | |
| β-strand | 170-178 | 9 | 4 |
| β-strand | 183-188 | 6 | 3 |
| β-strand | 191-197 | 7 | 2 |
| α-helix | 198-201 | 4 | |
| α-helix | 205-212 | 8 | |
| α-helix | 215-219 | 5 | |
| β-strand | 223-226 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-39 | 4 | 5 |
| β-strand | 41 | 1 | 6 |
| α-helix | 42-44 | 3 | |
| β-strand | 45-50 | 6 | 7 |
| α-helix | 60-74 | 15 | |
| β-strand | 77-84 | 8 | 8 |
| β-strand | 85-88 | 4 | 6 |
| β-strand | 91-99 | 9 | 6 |
| β-strand | 103-105 | 3 | 6 |
| β-strand | 108-110 | 3 | 8 |
| α-helix | 111-112 | 2 | |
| α-helix | 117-129 | 13 | |
| β-strand | 140-150 | 11 | 8 |
| β-strand | 158 | 1 | 8 |
| β-strand | 170-178 | 9 | 8 |
| α-helix | 179-180 | 2 | |
| β-strand | 183-188 | 6 | 7 |
| β-strand | 192-197 | 6 | 6 |
| α-helix | 198-201 | 4 | |
| α-helix | 205-212 | 8 | |
| α-helix | 215-219 | 5 | |
| β-strand | 223-226 | 4 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cleavage and polyadenylation specificity factor subunit 5 | A, B | protein | 197 | Homo sapiens | O43809 (AlphaFold model) |
>5R4R_1 Cleavage and polyadenylation specificity factor subunit 5 (chains A, B) SMLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHR LPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWR PNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGP IISSLPQLLSRFNFIYN
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 6 |
| RWA | (5R)-3,3,5-trimethyl-5-[(1-phenyl-1H-1,2,3-triazol-4-yl)methyl]pyrrolidine-2,4-… | C16 H18 N4 O2 | 2 |
Water and common crystallization additives (ACT) are not listed.
PanDDA analysis group deposition. Kidd, S.L., Mateu, N., Talon, R. et al. To be published.
Other PDB entries of the same protein (UniProt O43809 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5R4R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.