3BIT: Yeast Spt16 N-terminal Domain

Crystal structure of yeast Spt16 N-terminal Domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Dec 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 8,445
Mol. weight: 104.7 kDa
Released: 18 Dec 2007

Explore 3BIT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BIT contains 43 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	8-21	14
α-helix	22-24	3
β-strand	31-36	6	1
α-helix	47-56	10
β-strand	63-68	6	1
β-strand	71-77	7	1
α-helix	78-84	7
α-helix	87-90	4
β-strand	99-105	7	1
α-helix	110-127	18
β-strand	130-133	4	1
α-helix	142-158	17
β-strand	161-164	4	1
α-helix	166-172	7
α-helix	178-207	30
β-strand	213	1	2
α-helix	214-223	10
α-helix	224-226	3
α-helix	228-239	12
α-helix	243	1
α-helix	250-252	3
β-strand	253-255	3	3
β-strand	260-262	3	4
β-strand	279	1	2
α-helix	280	1
β-strand	284-290	7	4
β-strand	292-294	3	3
β-strand	297-298	2	3
β-strand	301-307	7	4
α-helix	311-326	16
α-helix	327-331	5
α-helix	338-352	15
α-helix	354-359	6
β-strand	360	1	4
β-strand	365-367	3	4
α-helix	375-377	3
β-strand	378	1	4
β-strand	393-404	12	4
β-strand	411-421	11	4
α-helix	429-430	2
β-strand	431-432	2	4
α-helix	440-443	4
β-strand	444-445	2	4

Chain B: 20 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	8-21	14
α-helix	22-24	3
β-strand	31-36	6	5
α-helix	47-56	10
β-strand	63-68	6	5
β-strand	71-77	7	5
α-helix	78-84	7
α-helix	87-90	4
β-strand	99-105	7	5
α-helix	110-127	18
β-strand	130-133	4	5
α-helix	142-158	17
β-strand	161-164	4	5
α-helix	166-172	7
α-helix	178-207	30
β-strand	213	1	6
α-helix	214-224	11
α-helix	228-239	12
α-helix	243	1
α-helix	250-252	3
β-strand	253-255	3	7
β-strand	260-262	3	8
β-strand	279	1	6
β-strand	284-290	7	8
β-strand	292-294	3	7
β-strand	297-298	2	7
β-strand	301-307	7	8
α-helix	311-326	16
α-helix	327-331	5
α-helix	338-352	15
α-helix	354-359	6
β-strand	360	1	8
β-strand	365-367	3	8
β-strand	378	1	8
β-strand	393-404	12	8
β-strand	411-421	11	8
α-helix	422-423	2
α-helix	429-430	2
β-strand	431-432	2	8
α-helix	440-443	4
β-strand	444-445	2	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FACT complex subunit SPT16	A, B	protein	453	Saccharomyces cerevisiae	P32558 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3BIT_1 FACT complex subunit SPT16 (chains A, B)
GHMEELNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSY
EFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFD
DVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDV
NEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDL
SALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYC
SNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVP
NFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLAD
TVQIPLDETEPPRFLTNYTKAKSQISFYFNNEE

Primary citation

Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits. VanDemark, A.P., Xin, H., McCullough, L. et al. J Biol Chem (2008) 283:5058-5068. DOI 10.1074/jbc.M708682200 · PubMed

Other PDB entries of the same protein (UniProt P32558 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BIQ 1.73 Å, Crystal structure of yeast Spt16 N-terminal Domain
4WNN 1.8 Å, SPT16-H2A-H2B FACT HISTONE Complex
3BIP 1.94 Å, Crystal structure of yeast Spt16 N-terminal Domain
4IOY 1.95 Å, Structure of the Spt16 Middle Domain Reveals Functional Features of the Histone…
7NKY 3.2 Å, RNA Polymerase II-Spt4/5-nucleosome-FACT structure
8XGC 3.7 Å, Structure of yeast replisome associated with FACT and histone hexamer, Composite map

Browse structure collections

About this viewer

MolViewer shows 3BIT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.