3BTV: PDB entry 3BTV

Crystal structure of the super-repressor mutant of Gal80p from Saccharomyces cerevisiae; Gal80(S0)-[G301R]. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 Mar 2008.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 6,380
Mol. weight: 97.51 kDa
Released: 4 Mar 2008

Explore 3BTV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BTV contains 29 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	17	1
β-strand	18-23	6	1
α-helix	36-42	7
β-strand	47-53	7	1
α-helix	57-66	10
β-strand	73-75	3	1
α-helix	78-83	6
β-strand	89-92	4	1
α-helix	96-109	14
α-helix	110-112	3
β-strand	118-122	5	1
α-helix	129-140	12
β-strand	145-149	5	1
α-helix	151-154	4
α-helix	156-166	11
β-strand	173-181	9	2
β-strand	188-190	3	3
α-helix	195-198	4
α-helix	206-211	6
α-helix	212-222	11
β-strand	226-234	9	2
β-strand	239-243	5	3
β-strand	249-255	7	3
β-strand	261-268	8	2
β-strand	273-280	8	2
β-strand	292-298	7	2
β-strand	302-306	5	2
β-strand	316-322	7	2
β-strand	348-353	6	2
α-helix	360-376	17
α-helix	402-421	20
β-strand	423	1	4
β-strand	425-426	2	2

Chain B: 15 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	17	1
β-strand	18-23	6	5
α-helix	36-42	7
β-strand	47-53	7	5
α-helix	57-66	10
β-strand	73-75	3	5
α-helix	78-83	6
β-strand	89-92	4	5
α-helix	96-98	3
α-helix	99-109	11
α-helix	110-112	3
β-strand	118-122	5	5
α-helix	129-140	12
β-strand	145-149	5	5
α-helix	151-154	4
α-helix	156-166	11
β-strand	173-181	9	6
β-strand	188-190	3	7
α-helix	195-198	4
α-helix	206-211	6
α-helix	212-222	11
β-strand	226-234	9	6
β-strand	239-243	5	7
β-strand	249-255	7	7
β-strand	261-268	8	6
β-strand	273-280	8	6
β-strand	292-298	7	6
β-strand	302-307	6	6
β-strand	316-321	6	6
β-strand	349-353	5	6
α-helix	360-377	18
α-helix	402-421	20
β-strand	423	1	4
β-strand	425-426	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galactose/lactose metabolism regulatory protein GAL80	A, B	protein	438	Saccharomyces cerevisiae	P04387 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3BTV_1 Galactose/lactose metabolism regulatory protein GAL80 (chains A, B)
GSHMDYNKRSSVSTVPNAAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKI
ETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLK
YLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIE
IAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNI
PEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIH
GTKRDLKLEGDAGFAEISNLVLYYSGTRANDFPLANGQQAPLDPGYDAGKEIMEVYHLRN
YNAIVGNIHRLYQSISDFHFNTKKIPELPSQFVMQGFDFEGFPTLMDALILHRLIESVYK
SNMMGSTLNVSNISHYSL

Primary citation

NADP regulates the yeast GAL induction system. Kumar, P.R., Yu, Y., Sternglanz, R. et al. Science (2008) 319:1090-1092. DOI 10.1126/science.1151903 · PubMed

Other PDB entries of the same protein (UniProt P04387 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V2U 2.1 Å, Crystal structure of the yeast GAL regulon complex of the repressor, Gal80p, and the…
3BTS 2.7 Å, Crystal structure of a ternary complex of the transcriptional repressor Gal80p (Gal80S0…
3BTU 2.85 Å, Crystal structure of the super-repressor mutant of Gal80p from Saccharomyces cerevisiae;…

Browse structure collections

About this viewer

MolViewer shows 3BTV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.