3BTS: PDB entry 3BTS

Name: PDB 3BTS: Crystal structure of a ternary complex of the transcriptional repressor Gal80p (Gal80S0 [G301R]) and the acidic activation domain of Gal4p (aa 854-874) from Saccharomyces cerevisiae with NAD
Published: 2008-03-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of a ternary complex of the transcriptional repressor Gal80p (Gal80S0 [G301R]) and the acidic activation domain of Gal4p (aa 854-874) from Saccharomyces cerevisiae with NAD. Determined by X-ray diffraction at 2.7 Å resolution. Released 4 Mar 2008.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 6,432
Mol. weight: 103.85 kDa
Ligands: NAD
Released: 4 Mar 2008

Explore 3BTS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BTS contains 36 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	17	1
β-strand	18-23	6	1
α-helix	31-34	4
α-helix	36-42	7
β-strand	47-53	7	1
α-helix	57-66	10
β-strand	73-75	3	1
α-helix	78-83	6
β-strand	89-92	4	1
α-helix	96-98	3
α-helix	99-109	11
α-helix	110-112	3
β-strand	118-121	4	1
α-helix	122	1
α-helix	129-142	14
β-strand	145-148	4	1
α-helix	151-154	4
α-helix	156-166	11
β-strand	173-181	9	2
β-strand	188-190	3	3
α-helix	196-198	3
α-helix	206-211	6
α-helix	212-221	10
β-strand	226-234	9	2
β-strand	239-243	5	3
β-strand	249-255	7	3
β-strand	261-268	8	2
α-helix	270-272	3
β-strand	274-280	7	2
β-strand	292-298	7	2
β-strand	302-307	6	2
β-strand	314-321	8	2
β-strand	349-353	5	2
α-helix	360-378	19
α-helix	402-421	20
β-strand	423	1	4
β-strand	425-426	2	2

Chain B: 18 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	16-17	2
β-strand	18-23	6	5
α-helix	31-34	4
α-helix	36-42	7
β-strand	47-53	7	5
α-helix	57-66	10
β-strand	73-75	3	5
α-helix	78-83	6
β-strand	89-92	4	5
α-helix	96-98	3
α-helix	99-109	11
α-helix	110-112	3
β-strand	118-121	4	5
α-helix	122	1
α-helix	129-142	14
β-strand	145-148	4	5
α-helix	151-154	4
α-helix	156-166	11
β-strand	173-181	9	6
β-strand	188-190	3	7
α-helix	196-198	3
α-helix	206-211	6
α-helix	212-221	10
β-strand	226-234	9	6
β-strand	239-243	5	7
β-strand	249-255	7	7
β-strand	261-268	8	6
α-helix	270-272	3
β-strand	274-280	7	6
β-strand	292-298	7	6
β-strand	301-307	7	6
β-strand	316-321	6	6
β-strand	349-353	5	6
α-helix	360-376	17
α-helix	402-421	20
β-strand	423	1	4
β-strand	425-426	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galactose/lactose metabolism regulatory protein GAL80	A, B	protein	438	Saccharomyces cerevisiae	P04387 (AlphaFold model)
Regulatory protein GAL4	E, F	protein	21		P04386 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3BTS_1 Galactose/lactose metabolism regulatory protein GAL80 (chains A, B)
GSHMDYNKRSSVSTVPNAAPIRVGFVGLNAAKGWAIKTHYPAILQLSSQFQITALYSPKI
ETSIATIQRLKLSNATAFPTLESFASSSTIDMIVIAIQVASHYEVVMPLLEFSKNNPNLK
YLFVEWALACSLDQAESIYKAAAERGVQTIISLQGRKSPYILRAKELISQGYIGDINSIE
IAGNGGWYGYERPVKSPKYIYEIGNGVDLVTTTFGHTIDILQYMTSSYFSRINAMVFNNI
PEQELIDERGNRLGQRVPKTVPDHLLFQGTLLNGNVPVSCSFKGGKPTKKFTKNLVIDIH
GTKRDLKLEGDAGFAEISNLVLYYSGTRANDFPLANGQQAPLDPGYDAGKEIMEVYHLRN
YNAIVGNIHRLYQSISDFHFNTKKIPELPSQFVMQGFDFEGFPTLMDALILHRLIESVYK
SNMMGSTLNVSNISHYSL

Sequence of entity 2 (E, F), FASTA

>3BTS_2 Regulatory protein GAL4 (chains E, F)
GMFNTTTMDDVYNYLFDDEDT

Ligands and cofactors

ID	Name	Formula	Copies
NAD	Nicotinamide-adenine-dinucleotide	C21 H27 N7 O14 P2	2

Primary citation

NADP regulates the yeast GAL induction system. Kumar, P.R., Yu, Y., Sternglanz, R. et al. Science (2008) 319:1090-1092. DOI 10.1126/science.1151903 · PubMed

Other PDB entries of the same protein (UniProt P04387 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BTV 2.1 Å, Crystal structure of the super-repressor mutant of Gal80p from Saccharomyces cerevisiae;…
3V2U 2.1 Å, Crystal structure of the yeast GAL regulon complex of the repressor, Gal80p, and the…
3BTU 2.85 Å, Crystal structure of the super-repressor mutant of Gal80p from Saccharomyces cerevisiae;…

Browse structure collections

About this viewer

MolViewer shows 3BTS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.