Structural Basis of Histone H4 Recognition by p55. Determined by X-ray diffraction at 2.9 Å resolution. Released 13 May 2008.
Explore 3C99 in 3D Show helices and sheets RCSB PDB PDBe
3C99 contains 5 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-35 | 24 | |
| β-strand | 36-43 | 8 | 1 |
| β-strand | 51-58 | 8 | 2 |
| β-strand | 65-73 | 9 | 2 |
| β-strand | 81-91 | 11 | 2 |
| α-helix | 115-117 | 3 | |
| β-strand | 119-127 | 9 | 2 |
| β-strand | 133-136 | 4 | 3 |
| β-strand | 143-147 | 5 | 3 |
| β-strand | 153-157 | 5 | 3 |
| β-strand | 175-177 | 3 | 3 |
| β-strand | 187-189 | 3 | 4 |
| β-strand | 196-200 | 5 | 4 |
| β-strand | 206-210 | 5 | 4 |
| β-strand | 220-221 | 2 | 3 |
| β-strand | 225-227 | 3 | 4 |
| β-strand | 234-239 | 6 | 5 |
| β-strand | 246-251 | 6 | 5 |
| β-strand | 255-260 | 6 | 5 |
| β-strand | 271-274 | 4 | 5 |
| β-strand | 280-285 | 6 | 6 |
| β-strand | 292-297 | 6 | 6 |
| β-strand | 301-306 | 6 | 6 |
| α-helix | 307-309 | 3 | |
| β-strand | 315-318 | 4 | 6 |
| β-strand | 324-329 | 6 | 7 |
| β-strand | 336-341 | 6 | 7 |
| β-strand | 346-350 | 5 | 7 |
| α-helix | 351-353 | 3 | |
| β-strand | 370-374 | 5 | 7 |
| β-strand | 381-386 | 6 | 1 |
| β-strand | 393-398 | 6 | 1 |
| β-strand | 402-408 | 7 | 1 |
| α-helix | 410-412 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromatin assembly factor 1 p55 subunit | A | protein | 432 | Drosophila melanogaster | Q24572 (AlphaFold model) |
>3C99_1 Chromatin assembly factor 1 p55 subunit (chains A) GAMVDRSDNAAESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVT KQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGK IEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLR GHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVA WHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSA DKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQ STEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEP EIPASELETNTA
| ID | Name | Formula | Copies |
|---|---|---|---|
| CD | Cadmium ion | Cd | 9 |
Structural basis of histone H4 recognition by p55. Song, J.J., Garlick, J.D., Kingston, R.E. Genes Dev (2008) 22:1313-1318. DOI 10.1101/gad.1653308 · PubMed
Other PDB entries of the same protein (UniProt Q24572 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3C99 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.