3C9C: Histone H4 Recognition by p55

Structural Basis of Histone H4 Recognition by p55. Determined by X-ray diffraction at 3.2 Å resolution. Released 13 May 2008.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 3,152
Mol. weight: 52.8 kDa
Ligands: CD
Released: 13 May 2008

Explore 3C9C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3C9C contains 6 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	12-35	24
β-strand	36-43	8	1
β-strand	52-53	2	2
β-strand	58	1	2
β-strand	65-73	9	2
β-strand	81-91	11	2
α-helix	115-117	3
β-strand	119-127	9	2
β-strand	133-137	5	3
β-strand	140-147	8	3
β-strand	153-157	5	3
β-strand	175-177	3	3
β-strand	187-189	3	4
β-strand	196-200	5	4
β-strand	206-210	5	4
β-strand	220-221	2	3
β-strand	225-227	3	4
β-strand	234-239	6	5
β-strand	246-251	6	5
β-strand	256-260	5	5
β-strand	271-273	3	5
β-strand	280-283	4	6
β-strand	292-297	6	6
β-strand	301-306	6	6
α-helix	307-309	3
β-strand	315-318	4	6
β-strand	324-329	6	7
β-strand	336-341	6	7
β-strand	346-350	5	7
α-helix	351-353	3
β-strand	370-374	5	7
β-strand	381-386	6	1
β-strand	393-398	6	1
β-strand	402-408	7	1
α-helix	410-412	3

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	33-39	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromatin assembly factor 1 p55 subunit	A	protein	432	Drosophila melanogaster	Q24572 (AlphaFold model)
Histone H4, 27-residue peptide	B	protein	27		P84040 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3C9C_1 Chromatin assembly factor 1 p55 subunit (chains A)
GAMVDRSDNAAESFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVT
KQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGK
IEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLR
GHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVEDVA
WHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSA
DKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQ
STEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEP
EIPASELETNTA

Sequence of entity 2 (B), FASTA

>3C9C_2 Histone H4, 27-residue peptide (chains B)
AKRHRKVLRDNIQGITKPAIRRLARRG

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	7

Primary citation

Structural basis of histone H4 recognition by p55. Song, J.J., Garlick, J.D., Kingston, R.E. Genes Dev (2008) 22:1313-1318. DOI 10.1101/gad.1653308 · PubMed

Other PDB entries of the same protein (UniProt Q24572 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XYI 1.75 Å, Crystal Structure of Nurf55 in complex with a H4 peptide
2YB8 2.3 Å, Crystal structure of Nurf55 in complex with Su(z)12
2YBA 2.55 Å, Crystal structure of Nurf55 in complex with histone H3
3C99 2.9 Å, Structural Basis of Histone H4 Recognition by p55

Browse structure collections

About this viewer

MolViewer shows 3C9C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.