3COM: Mst1 kinase

Crystal structure of Mst1 kinase. Determined by X-ray diffraction at 2.2 Å resolution. Released 15 Apr 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,514
Mol. weight: 71.59 kDa
Released: 15 Apr 2008

Explore 3COM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3COM contains 40 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	30-35	6	1
β-strand	43-49	7	1
β-strand	55-62	8	1
α-helix	68-78	11
β-strand	85	1	2
α-helix	86-87	2
β-strand	88-94	7	1
β-strand	97-103	7	1
β-strand	108-109	2	2
α-helix	110-117	8
α-helix	120-122	3
α-helix	123-142	20
β-strand	145-146	2	3
α-helix	152-154	3
β-strand	155-157	3	2
β-strand	163-165	3	2
β-strand	172-173	2	3
β-strand	175	1	4
β-strand	178	1	4
β-strand	181	1	5
α-helix	188-190	3
α-helix	193-196	4
β-strand	201	1	5
α-helix	205-219	15
α-helix	229-238	10
α-helix	240-242	3
α-helix	247-249	3
α-helix	252-261	10
α-helix	270-271	2
α-helix	272-275	4
α-helix	279-282	4
α-helix	284-286	3
α-helix	287-290	4
α-helix	291-297	7

Chain B: 21 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	19-22	4
α-helix	26-29	4
β-strand	30-35	6	6
β-strand	44-49	6	6
β-strand	55-62	8	6
α-helix	67-77	11
β-strand	85	1	7
α-helix	86-87	2
β-strand	88-94	7	6
β-strand	97-103	7	6
β-strand	108-109	2	7
α-helix	110-117	8
α-helix	120-122	3
α-helix	123-142	20
β-strand	145-146	2	8
α-helix	152-154	3
β-strand	155-157	3	7
β-strand	163-165	3	7
β-strand	172-173	2	8
β-strand	175	1	9
β-strand	178	1	9
β-strand	181	1	10
α-helix	188-190	3
α-helix	193-196	4
β-strand	201	1	10
α-helix	205-219	15
α-helix	229-235	7
α-helix	240-242	3
α-helix	247-249	3
α-helix	252-261	10
α-helix	270-271	2
α-helix	272-275	4
α-helix	279-282	4
α-helix	284-286	3
α-helix	287-290	4
α-helix	291-299	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 4	A, B	protein	314	Homo sapiens	Q13043 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3COM_1 Serine/threonine-protein kinase 4 (chains A, B)
SLETVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIK
QVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNK
TLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMA
KRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTN
PPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMD
VKLKRQESQQREEG

Primary citation

Crystal structure of Mst1 kinase. Atwell, S., Burley, S.K., Dickey, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q13043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8PAV 1.9 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
4NR2 2.0 Å, Crystal structure of STK4 (MST1) SARAH domain
8A5J 2.12 Å, Crystal structure of Human STE20-like kinase 1, MST1 in complex with compound XMU-MP-1
8PAW 2.14 Å, Crystal structure of MST1 with a MAP4K1 SMOL inhibitor
4OH8 2.28 Å, Crystal Structure of the human MST1-RASSF5 SARAH heterodimer
5TWG 2.3 Å, human MOB1A bound to human MST1 phosphorylated T353 peptide
9VX3 2.39 Å, Crystal structure of the peptide-bound form of HisMab-1 Fv-clasp
5TWH 2.5 Å, human MOB1A bound to MST1 phosphorylated T367 peptide
7CEA 2.55 Å, Crystal structure of HUTS-4 Fv-clasp fragment
6YAT 2.58 Å, Crystal structure of STK4 (MST1) in complex with compound 6
9IIC 2.78 Å, Crystal structure of HOIP RING2-LDD in complex with STK4 KD domain
7CEB 2.89 Å, Crystal structure of alpha6beta1 integrin headpiece

Browse structure collections

About this viewer

MolViewer shows 3COM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.