Crystal structure of AIM1g1. Determined by X-ray diffraction at 1.88 Å resolution. Released 17 Jun 2008.
Explore 3CW3 in 3D Show helices and sheets RCSB PDB PDBe
3CW3 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 1 |
| β-strand | 16-18 | 3 | 1 |
| β-strand | 22 | 1 | 2 |
| β-strand | 33-40 | 8 | 1 |
| β-strand | 42-48 | 7 | 2 |
| β-strand | 52-58 | 7 | 2 |
| β-strand | 61-66 | 6 | 1 |
| α-helix | 73-75 | 3 | |
| α-helix | 86-87 | 2 | |
| β-strand | 91-95 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Absent in melanoma 1 protein | A | protein | 96 | Homo sapiens | Q9Y4K1 (AlphaFold model) |
>3CW3_1 Absent in melanoma 1 protein (chains A) GKVVIYSEPDVSEKCIEVFSDIQDCSSWSLSPVILIKVVRGCWILYEQPNFEGHSIPLEE GELELSGLWGIEDILERHEEAESDKPVVIGSIRHVV
Exploring the limits of sequence and structure in a variant betagamma-crystallin domain of the protein absent in melanoma-1 (AIM1). Aravind, P., Wistow, G., Sharma, Y. et al. J Mol Biol (2008) 381:509-518. DOI 10.1016/j.jmb.2008.06.019 · PubMed
Other PDB entries of the same protein (UniProt Q9Y4K1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3CW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.