Crystal structure of the human Fe65-PTB1 domain (trigonal crystal form). Determined by X-ray diffraction at 2.8 Å resolution. Released 10 Jun 2008.
Explore 3D8E in 3D Show helices and sheets RCSB PDB PDBe
3D8E contains 15 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 369-380 | 12 | 1 |
| α-helix | 382-385 | 4 | |
| α-helix | 390-401 | 12 | |
| β-strand | 421-427 | 7 | 1 |
| β-strand | 430-435 | 6 | 1 |
| β-strand | 440-446 | 7 | 1 |
| α-helix | 447-449 | 3 | |
| β-strand | 450-455 | 6 | 1 |
| β-strand | 464-470 | 7 | 1 |
| β-strand | 477-484 | 8 | 1 |
| α-helix | 489-503 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 368-380 | 13 | 1 |
| α-helix | 382-385 | 4 | |
| α-helix | 389-399 | 11 | |
| β-strand | 421-427 | 7 | 1 |
| β-strand | 430-434 | 5 | 1 |
| β-strand | 441-443 | 3 | 1 |
| β-strand | 446 | 1 | 1 |
| α-helix | 447-449 | 3 | |
| β-strand | 450-455 | 6 | 1 |
| β-strand | 464-470 | 7 | 1 |
| β-strand | 477-484 | 8 | 1 |
| α-helix | 488-504 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 369-379 | 11 | 2 |
| α-helix | 390-401 | 12 | |
| β-strand | 422-427 | 6 | 2 |
| β-strand | 430-434 | 5 | 2 |
| β-strand | 441-446 | 6 | 2 |
| α-helix | 447-449 | 3 | |
| β-strand | 450-455 | 6 | 2 |
| β-strand | 464-470 | 7 | 2 |
| β-strand | 477-484 | 8 | 2 |
| α-helix | 488-504 | 17 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 368-379 | 12 | 2 |
| α-helix | 383-385 | 3 | |
| α-helix | 389-400 | 12 | |
| β-strand | 421-427 | 7 | 2 |
| β-strand | 430-434 | 5 | 2 |
| β-strand | 441-443 | 3 | 2 |
| β-strand | 446 | 1 | 2 |
| α-helix | 447-449 | 3 | |
| β-strand | 450-455 | 6 | 2 |
| β-strand | 464-470 | 7 | 2 |
| β-strand | 477-484 | 8 | 2 |
| α-helix | 488-504 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Amyloid beta A4 precursor protein-binding family B member 1 | A, B, C, D | protein | 148 | Homo sapiens | O00213 (AlphaFold model) |
>3D8E_1 Amyloid beta A4 precursor protein-binding family B member 1 (chains A, B, C, D) GIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGKDLLLQ LEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCE APAKNIATSLHEICSKIMAELEHHHHHH
Crystal structure of the human Fe65-PTB1 domain. Radzimanowski, J., Ravaud, S., Schlesinger, S. et al. J Biol Chem (2008) 283:23113-23120. DOI 10.1074/jbc.M800861200 · PubMed
Other PDB entries of the same protein (UniProt O00213 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3D8E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.