3D9H: PDB entry 3D9H

Crystal Structure of the Splice Variant of Human ASB9 (hASB9-2), an Ankyrin Repeat Protein. Determined by X-ray diffraction at 2.2 Å resolution. Released 2 Jun 2009.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,980
Mol. weight: 30.43 kDa
Released: 2 Jun 2009

Explore 3D9H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3D9H contains 14 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	22-23	2	1
α-helix	39-45	7
α-helix	49-57	9
β-strand	64-65	2	1
α-helix	72-78	7
α-helix	82-90	9
α-helix	105-112	8
α-helix	115-123	9
α-helix	137-144	8
α-helix	147-155	9
β-strand	164	1	2
β-strand	168	1	2
α-helix	170-176	7
α-helix	180-188	9
β-strand	197	1	3
β-strand	200	1	3
α-helix	202-208	7
α-helix	212-220	9
α-helix	235-238	4
α-helix	244-252	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cDNA FLJ77766, highly similar to Homo sapiens ankyrin repeat and SOCS box-containing 9 (ASB9),…	A	protein	285	Homo sapiens	Q96DX5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3D9H_1 cDNA FLJ77766, highly similar to Homo sapiens ankyrin repeat and SOCS box-containing 9 (ASB9), transcript variant 2, mRNA (chains A)
MGSSHHHHHHSSGLVPRGSHMASMDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDW
SPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNG
VTADWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYG
GNIDHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVVRTASEELACL
LMDFGADTQAKNAEGKRPVELVPPESPLAQLFLEREGASLPKPKP

Primary citation

Crystal Structure of the Splice Variant of Human ASB9 (hASB9-2), an Ankyrin Repeat Protein. Fei, X., Gu, X., Fan, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q96DX5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZKJ 2.58 Å, Crystal Structure of Ankyrin Repeat and Socs Box-Containing Protein 9 (Asb9) in Complex…
3ZNG 2.85 Å, Ankyrin repeat and SOCS-box protein 9 (ASB9) in complex with ElonginB and ElonginC
6V9H 4.1 Å, Ankyrin repeat and SOCS-box protein 9 (ASB9), ElonginB (ELOB), and ElonginC (ELOC) bound…

Browse structure collections

About this viewer

MolViewer shows 3D9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.