6V9H: Creatine kinase B-type

Ankyrin repeat and SOCS-box protein 9 (ASB9), ElonginB (ELOB), and ElonginC (ELOC) bound to its substrate Brain-type Creatine Kinase (CKB). Determined by electron microscopy at 4.1 Å resolution. Released 29 Apr 2020.

Method: Electron microscopy
Resolution: 4.1 Å
Organism: Homo sapiens
Chains: 5
Atoms: 9,326
Mol. weight: 143.71 kDa
Released: 29 Apr 2020

Explore 6V9H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V9H contains 71 α-helices and 48 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
α-helix	16-19	4
β-strand	27	1	1
α-helix	29-33	5
α-helix	36-42	7
β-strand	46	1	2
β-strand	52	1	2
α-helix	53-56	4
α-helix	58-62	5
β-strand	65	1	1
α-helix	81-84	4
α-helix	86-96	11
α-helix	112-114	3
β-strand	126-135	10	3
β-strand	137	1	4
β-strand	138	1	5
β-strand	140	1	5
α-helix	148-163	16
α-helix	167-169	3
β-strand	171-175	5	3
α-helix	176-178	3
α-helix	181-189	9
α-helix	200-203	4
β-strand	216-220	5	3
β-strand	225-229	5	3
β-strand	235-242	8	3
α-helix	246-266	21
β-strand	271	1	4
β-strand	273-274	2	6
β-strand	278-279	2	6
α-helix	284-286	3
β-strand	288	1	6
β-strand	292-297	6	3
α-helix	308-315	8
β-strand	317-320	4	3
β-strand	334-338	5	3
α-helix	347-368	22
α-helix	374-376	3

Chain B: 23 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-11	5
α-helix	16-19	4
α-helix	23-25	3
α-helix	30-32	3
α-helix	36-42	7
α-helix	53-56	4
α-helix	58-62	5
α-helix	79-84	6
α-helix	86-96	11
α-helix	105-107	3
α-helix	112-114	3
β-strand	126-135	10	7
β-strand	137	1	8
α-helix	143-145	3
α-helix	148-162	15
α-helix	167-169	3
β-strand	171-175	5	7
α-helix	176-178	3
α-helix	181-189	9
α-helix	200-203	4
β-strand	216-220	5	7
β-strand	225-229	5	7
β-strand	235-242	8	7
α-helix	246-265	20
β-strand	271	1	8
β-strand	273-274	2	9
β-strand	278-279	2	9
α-helix	284-286	3
β-strand	288	1	9
β-strand	292-297	6	7
α-helix	302-304	3
α-helix	308-314	7
β-strand	317-319	3	7
β-strand	334-338	5	7
α-helix	346-368	23
α-helix	374-376	3

Chain C: 20 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	33-35	3
α-helix	39-46	8
α-helix	49-58	10
β-strand	66	1	10
β-strand	70	1	10
α-helix	72-79	8
α-helix	82-90	9
α-helix	105-112	8
α-helix	115-123	9
α-helix	137-144	8
α-helix	147-157	11
α-helix	165-167	3
α-helix	170-176	7
α-helix	180-189	10
β-strand	197	1	11
β-strand	200	1	11
α-helix	202-209	8
α-helix	212-220	9
α-helix	235-238	4
α-helix	244-251	8
α-helix	255-257	3
α-helix	258-267	10
α-helix	275-280	6
α-helix	285-292	8

Chain D: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	19-22	4	12
β-strand	28-31	4	12
α-helix	33-36	4
α-helix	40-44	5
β-strand	60-61	2	12
α-helix	67-82	16
α-helix	91-94	4
α-helix	97-110	14

Chain E: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	12
β-strand	10	1	13
β-strand	12-18	7	12
β-strand	23	1	14
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	12
β-strand	49-50	2	12
α-helix	51-52	2
β-strand	56	1	14
β-strand	73-79	7	12
β-strand	90	1	13
α-helix	91-100	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Creatine kinase B-type	A, B	protein	381	Homo sapiens	P12277 (AlphaFold model)
Ankyrin repeat and SOCS box protein 9	C	protein	314	Homo sapiens	Q96DX5 (AlphaFold model)
Elongin-C	D	protein	97	Homo sapiens	Q15369 (AlphaFold model)
Elongin-B	E	protein	118	Homo sapiens	Q15370 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6V9H_1 Creatine kinase B-type (chains A, B)
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK

Sequence of entity 2 (C), FASTA

>6V9H_2 Ankyrin repeat and SOCS box protein 9 (chains C)
MKHHHHHHHHGGLVPRGSHGMDGKQGGMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPM
HEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTA
DWHTPLFNACVSGSWDCVNLLLQHGASVQPESDLASPIHEAARRGHVECVNSLIAYGGNI
DHKISHLGTPLYLACENQQRACVKKLLESGADVNQGKGQDSPLHAVARTASEELACLLMD
FGADTQAKNAEGKRPVELVPPESPLAQLFLEREGPPSLMQLCRLRIRKCFGIQQHHKITK
LVLPEDLKQFLLHL

Sequence of entity 3 (D), FASTA

>6V9H_3 Elongin-C (chains D)
MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCM
YFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence of entity 4 (E), FASTA

>6V9H_4 Elongin-B (chains E)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Primary citation

Structure and dynamics of the ASB9 CUL-RING E3 Ligase. Lumpkin, R.J., Baker, R.W., Leschziner, A.E. et al. Nat Commun (2020) 11:2866-2866. DOI 10.1038/s41467-020-16499-9 · PubMed

Other PDB entries of the same protein (UniProt P12277 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BF1 1.24 Å, Ca2+-Calmodulin in complex with peptide from brain-type creatine kinase in extended 1:2…
3B6R 2.0 Å, Crystal structure of Human Brain-type Creatine Kinase
3DRB 2.0 Å, Crystal structure of Human Brain-type Creatine Kinase
3DRE 2.2 Å, Crystal structure of Human Brain-type Creatine Kinase
7TUN 2.93 Å, Crystal structure analysis of human CKB complex with a covalent compound

Browse structure collections

About this viewer

MolViewer shows 6V9H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.