Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of the Carboxy-Terminal Domain of RNA-Polymerase II. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Jun 2008.
Explore 3D9K in 3D Show helices and sheets RCSB PDB PDBe
3D9K contains 27 α-helices and 2 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-12 | 10 | |
| α-helix | 13-16 | 4 | |
| α-helix | 18 | 1 | |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 1 |
| α-helix | 23-35 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-53 | 14 | |
| α-helix | 56-58 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 84-99 | 16 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-119 | 13 | |
| α-helix | 125-137 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-12 | 11 | |
| α-helix | 13-16 | 4 | |
| α-helix | 18 | 1 | |
| α-helix | 21-22 | 2 | |
| α-helix | 23-35 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-53 | 14 | |
| α-helix | 56-58 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 84-90 | 7 | |
| α-helix | 92-99 | 8 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-119 | 13 | |
| α-helix | 125-139 | 15 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 0 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNA-binding protein 16 | A, B | protein | 145 | Homo sapiens | Q9UPN6 (AlphaFold model) |
| Ctd-peptide | Y, Z | protein | 14 | P24928 (AlphaFold model) |
>3D9K_1 RNA-binding protein 16 (chains A, B) MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKV PGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKN NVFKSEIIQPLLDMAAALEHHHHHH
>3D9K_2 CTD-PEPTIDE (chains Y, Z) YSPTSPSYSPTSPS
Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II. Becker, R., Loll, B., Meinhart, A. J Biol Chem (2008) 283:22659-22669. DOI 10.1074/jbc.M803540200 · PubMed
Other PDB entries of the same protein (UniProt Q9UPN6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3D9K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.