3D9T: CIAP1-BIR3

CIAP1-BIR3 in complex with N-terminal peptide from Caspase-9 (ATPFQE). Determined by X-ray diffraction at 1.5 Å resolution. Released 10 Jun 2008.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,909
Mol. weight: 23.86 kDa
Ligands: ZN
Released: 10 Jun 2008

Explore 3D9T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3D9T contains 14 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	258-260	3
α-helix	263-268	6
α-helix	269-272	4
α-helix	281-286	6
β-strand	289-291	3	1
β-strand	298-300	3	1
β-strand	306-308	3	1
α-helix	316-323	8
β-strand	327	1	2
α-helix	328-334	7
α-helix	336-342	7

Chain B: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	258-260	3
α-helix	263-268	6
α-helix	269-272	4
α-helix	281-286	6
β-strand	289-291	3	3
β-strand	294	1	2
β-strand	298-300	3	3
β-strand	306-308	3	3
α-helix	316-323	8
α-helix	328-334	7
α-helix	336-343	8

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-4	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 2	A, B	protein	97	Homo sapiens	Q13490 (AlphaFold model)
Caspase-9	C, D	protein	6		P55211 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3D9T_1 Baculoviral IAP repeat-containing protein 2 (chains A, B)
GPGSSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRC
WESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRY

Sequence of entity 2 (C, D), FASTA

>3D9T_2 Caspase-9 (chains C, D)
ATPFQE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The structure of the BIR3 domain of cIAP1 in complex with the N-terminal peptides of SMAC and caspase-9. Kulathila, R., Vash, B., Sage, D. et al. Acta Crystallogr D Biol Crystallogr (2009) 65:58-66. DOI 10.1107/S0907444908039243 · PubMed

Other PDB entries of the same protein (UniProt Q13490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HY4 1.25 Å, Crystal structure of cIAP1 BIR3 bound to T3170284
7QGJ 1.3 Å, Apo structure of BIR2 Domain of BIRC2
8DSF 1.5 Å, Structure of cIAP1 with BCCov
4KMN 1.52 Å, Structure of cIAP1-BIR3 and inhibitor
4LGE 1.55 Å, Crystal structure of clAP1 BIR3 bound to T3261256
6HPR 1.7 Å, Crystal structure of cIAP1 RING domain bound to UbcH5B-Ub and a non-covalent Ub
7TRL 1.74 Å, Crystal structure of human BIRC2 BIR3 domain in complex with histone H3
4HY5 1.75 Å, Crystal structure of cIAP1 BIR3 bound to T3256336
3UW4 1.79 Å, Crystal structure of cIAP1 BIR3 bound to GDC0152
4MU7 1.79 Å, Crystal structure of cIAP1 BIR3 bound to T3450325
5M6N 1.8 Å, Small Molecule inhibitors of IAP
9N23 1.8 Å, Crystal structure of cIAP1-BIR3 with XB2 series SMAC mimetic ligand

Browse structure collections

About this viewer

MolViewer shows 3D9T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.