Crystal structure of cIAP1 BIR3 bound to T3256336. Determined by X-ray diffraction at 1.75 Å resolution. Released 30 Jan 2013.
Explore 4HY5 in 3D Show helices and sheets RCSB PDB PDBe
4HY5 contains 14 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 258-260 | 3 | |
| α-helix | 263-268 | 6 | |
| α-helix | 269-272 | 4 | |
| α-helix | 281-286 | 6 | |
| β-strand | 289-291 | 3 | 1 |
| β-strand | 298-300 | 3 | 1 |
| β-strand | 306-307 | 2 | 1 |
| α-helix | 316-323 | 8 | |
| α-helix | 328-334 | 7 | |
| α-helix | 336-343 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 258-260 | 3 | |
| α-helix | 263-268 | 6 | |
| α-helix | 269-272 | 4 | |
| α-helix | 281-286 | 6 | |
| β-strand | 289-291 | 3 | 2 |
| β-strand | 298-300 | 3 | 2 |
| β-strand | 306-307 | 2 | 2 |
| α-helix | 316-323 | 8 | |
| α-helix | 328-334 | 7 | |
| α-helix | 336-342 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Baculoviral IAP repeat-containing protein 2 | A, B | protein | 115 | Homo sapiens | Q13490 (AlphaFold model) |
>4HY5_1 Baculoviral IAP repeat-containing protein 2 (chains A, B) MGSSHHHHHHSSGENLYFQGGSSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYY VGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRY
| ID | Name | Formula | Copies |
|---|---|---|---|
| 1AQ | (3S,7R,8aR)-2-{(2S)-2-(4,4-difluorocyclohexyl)-2-[(N-methyl-L-alanyl)amino]acet… | C31 H45 F2 N5 O5 | 2 |
| ZN | Zinc ion | Zn | 2 |
Design and Synthesis of Potent Inhibitor of Apoptosis (IAP) Proteins Antagonists Bearing an Octahydropyrrolo[1,2-a]pyrazine Scaffold as a Novel Proline Mimetic. Hashimoto, K., Saito, B., Miyamoto, N. et al. J Med Chem (2013) 56:1228-1246. DOI 10.1021/jm301674z · PubMed
Other PDB entries of the same protein (UniProt Q13490 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4HY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.