7QGJ: Apo structure of BIR2 Domain of BIRC2

Apo structure of BIR2 Domain of BIRC2. Determined by X-ray diffraction at 1.3 Å resolution. Released 9 Feb 2022.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,477
Mol. weight: 19.74 kDa
Ligands: ZN
Released: 9 Feb 2022

Explore 7QGJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QGJ contains 8 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	184-188	5
α-helix	201-206	6
β-strand	209-211	3	1
β-strand	218-220	3	1
β-strand	226-227	2	1
α-helix	236-243	8
α-helix	248-251	4

Chain B: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	184-188	5
α-helix	201-206	6
β-strand	209-211	3	2
β-strand	218-220	3	2
β-strand	226-227	2	2
α-helix	236-243	8
α-helix	248-250	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 2	A, B	protein	83	Homo sapiens	Q13490 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7QGJ_1 Baculoviral IAP repeat-containing protein 2 (chains A, B)
SNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPK
DDAMSEHRRHFPNCPFLENSLET

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (EDO) are not listed.

Primary citation

Apo structure BIR2 Domain of BIRC2. Kraemer, A., Farges, F., Schwalm, M.P. et al. To be published.

Other PDB entries of the same protein (UniProt Q13490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HY4 1.25 Å, Crystal structure of cIAP1 BIR3 bound to T3170284
3D9T 1.5 Å, CIAP1-BIR3 in complex with N-terminal peptide from Caspase-9 (ATPFQE)
8DSF 1.5 Å, Structure of cIAP1 with BCCov
4KMN 1.52 Å, Structure of cIAP1-BIR3 and inhibitor
4LGE 1.55 Å, Crystal structure of clAP1 BIR3 bound to T3261256
6HPR 1.7 Å, Crystal structure of cIAP1 RING domain bound to UbcH5B-Ub and a non-covalent Ub
7TRL 1.74 Å, Crystal structure of human BIRC2 BIR3 domain in complex with histone H3
4HY5 1.75 Å, Crystal structure of cIAP1 BIR3 bound to T3256336
3UW4 1.79 Å, Crystal structure of cIAP1 BIR3 bound to GDC0152
4MU7 1.79 Å, Crystal structure of cIAP1 BIR3 bound to T3450325
5M6N 1.8 Å, Small Molecule inhibitors of IAP
9N23 1.8 Å, Crystal structure of cIAP1-BIR3 with XB2 series SMAC mimetic ligand

Browse structure collections

About this viewer

MolViewer shows 7QGJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.