3DOF: Complex of ARL2 and BART, Crystal Form 2

Complex of ARL2 and BART, Crystal Form 2. Determined by X-ray diffraction at 3.3 Å resolution. Released 3 Mar 2009.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,574
Mol. weight: 41.5 kDa
Ligands: MG, GTP
Released: 3 Mar 2009

Explore 3DOF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DOF contains 18 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
β-strand	16-22	7	1
α-helix	29-37	9
α-helix	44-47	4
β-strand	50-57	8	1
β-strand	60-67	8	1
α-helix	74-79	6
β-strand	86-92	7	1
α-helix	99-109	11
β-strand	119-125	7	1
α-helix	132-134	3
α-helix	135-140	6
α-helix	141-143	3
β-strand	152-156	5	1
β-strand	158	1	2
β-strand	163	1	2
α-helix	165-188	24

Chain B: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	18-25	8
α-helix	27-30	4
α-helix	35-45	11
β-strand	58	1	1
α-helix	59	1
α-helix	62-81	20
α-helix	90-97	8
α-helix	109-112	4
α-helix	114-116	3
α-helix	118-131	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor-like protein 2	A	protein	192	Homo sapiens	P36404 (AlphaFold model)
ADP-ribosylation factor-like protein 2-binding protein	B	protein	165	Homo sapiens	Q9Y2Y0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3DOF_1 ADP-ribosylation factor-like protein 2 (chains A)
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGF
KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATL
LIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI
FTADLEHHHHHH

Sequence of entity 2 (B), FASTA

>3DOF_2 ADP-ribosylation factor-like protein 2-binding protein (chains B)
GSMDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEEN
KLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDF
LAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1

Primary citation

Crystal structure of the ARL2-GTP-BART complex reveals a novel recognition and binding mode of small GTPase with effector. Zhang, T., Li, S., Zhang, Y. et al. Structure (2009) 17:602-610. DOI 10.1016/j.str.2009.01.014 · PubMed

Other PDB entries of the same protein (UniProt P36404 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9M1J 2.14 Å, Cryo-EM structure of the TBC-DE-Arl2-beta-tubulin complex
9M1M 2.21 Å, Cryo-EM structure of the TBC-DEC-Arl2-alpha-beta-tubulin complex with GDP-AlFx
9M1N 2.24 Å, Cryo-EM structure of the TBC-DC-Arl2-alpha-beta-tubulin complex with GDP-AlFx
3DOE 2.25 Å, Complex of ARL2 and BART, Crystal Form 1
9M1K 2.45 Å, Cryo-EM structure of the TBC-DE-Arl2-beta-tubulin complex with GTP
9M1I 2.48 Å, Cryo-EM structure of the TBC-D-Arl2-beta-tubulin complex
9M1L 2.55 Å, Cryo-EM structure of the TBC-DE-Arl2-alpha-beta-tubulin complex with GTP

Browse structure collections

About this viewer

MolViewer shows 3DOF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.