3DRB: Human Brain-type Creatine Kinase

Crystal structure of Human Brain-type Creatine Kinase. Determined by X-ray diffraction at 2.0 Å resolution. Released 17 Mar 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,478
Mol. weight: 85.85 kDa
Ligands: ADP, MG
Released: 17 Mar 2009

Explore 3DRB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DRB contains 37 α-helices and 37 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	7-12	6
α-helix	16-19	4
β-strand	27	1	1
β-strand	28	1	2
α-helix	29-33	5
α-helix	36-42	7
β-strand	46	1	3
β-strand	52	1	3
α-helix	53-62	10
β-strand	65	1	1
β-strand	71	1	2
α-helix	81-84	4
α-helix	86-96	11
α-helix	112-114	3
β-strand	126-135	10	4
β-strand	137	1	5
α-helix	148-164	17
α-helix	167-169	3
β-strand	171-175	5	4
α-helix	181-189	9
α-helix	200-203	4
β-strand	216-220	5	4
β-strand	225-229	5	4
β-strand	235-242	8	4
α-helix	246-265	20
β-strand	271	1	5
β-strand	273-274	2	6
β-strand	278-279	2	6
α-helix	284-286	3
β-strand	288	1	6
β-strand	292-298	7	4
α-helix	302-304	3
α-helix	308-314	7
β-strand	317-321	5	4
α-helix	325-330	6
β-strand	333-338	6	4
α-helix	346-368	23
α-helix	374-376	3
α-helix	377-380	4

Chain B: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	7-11	5
α-helix	16-19	4
β-strand	28	1	7
α-helix	29-33	5
α-helix	36-42	7
α-helix	53-62	10
β-strand	71	1	7
α-helix	81-84	4
α-helix	86-96	11
α-helix	112-114	3
β-strand	126-135	10	8
β-strand	137	1	9
α-helix	148-162	15
α-helix	167-169	3
β-strand	171-175	5	8
α-helix	176-178	3
α-helix	181-189	9
α-helix	200-204	5
β-strand	216-220	5	8
β-strand	225-229	5	8
β-strand	235-242	8	8
α-helix	246-266	21
β-strand	271	1	9
β-strand	273-274	2	10
β-strand	278-279	2	10
α-helix	284-286	3
β-strand	288	1	10
β-strand	292-298	7	8
α-helix	308-314	7
β-strand	317-320	4	8
β-strand	321	1	11
β-strand	324	1	11
β-strand	330	1	8
β-strand	333-338	6	8
α-helix	346-364	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Creatine kinase B-type	A, B	protein	381	Homo sapiens	P12277 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DRB_1 Creatine kinase B-type (chains A, B)
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MG	Magnesium ion	Mg	1

Primary citation

Structural studies of human brain-type creatine kinase complexed with the ADP-Mg2+-NO3- -creatine transition-state analogue complex. Bong, S.M., Moon, J.H., Nam, K.H. et al. FEBS Lett (2008) 582:3959-3965. DOI 10.1016/j.febslet.2008.10.039 · PubMed

Other PDB entries of the same protein (UniProt P12277 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BF1 1.24 Å, Ca2+-Calmodulin in complex with peptide from brain-type creatine kinase in extended 1:2…
3B6R 2.0 Å, Crystal structure of Human Brain-type Creatine Kinase
3DRE 2.2 Å, Crystal structure of Human Brain-type Creatine Kinase
7TUN 2.93 Å, Crystal structure analysis of human CKB complex with a covalent compound
6V9H 4.1 Å, Ankyrin repeat and SOCS-box protein 9 (ASB9), ElonginB (ELOB), and ElonginC (ELOC) bound…

Browse structure collections

About this viewer

MolViewer shows 3DRB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.