Crystal structure of spatzle cystine knot. Determined by X-ray diffraction at 2.4 Å resolution. Released 23 Sept 2008.
Explore 3E07 in 3D Show helices and sheets RCSB PDB PDBe
3E07 contains 7 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-8 | 2 | 1 |
| β-strand | 12-17 | 6 | 2 |
| α-helix | 38 | 1 | |
| β-strand | 39-41 | 3 | 3 |
| β-strand | 42-47 | 6 | 2 |
| β-strand | 53 | 1 | 4 |
| α-helix | 54 | 1 | |
| α-helix | 57-59 | 3 | |
| β-strand | 65-74 | 10 | 4 |
| β-strand | 76-80 | 5 | 5 |
| β-strand | 86-89 | 4 | 5 |
| β-strand | 94-104 | 11 | 4 |
| α-helix | 105-107 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-8 | 3 | 4 |
| β-strand | 12-17 | 6 | 6 |
| β-strand | 39-41 | 3 | 5 |
| β-strand | 42-47 | 6 | 6 |
| β-strand | 53 | 1 | 1 |
| α-helix | 54 | 1 | |
| α-helix | 57-59 | 3 | |
| α-helix | 62-64 | 3 | |
| β-strand | 67-73 | 7 | 1 |
| β-strand | 76-80 | 5 | 3 |
| β-strand | 86-90 | 5 | 3 |
| β-strand | 95-103 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein spaetzle | A, B | protein | 114 | Drosophila melanogaster | P48607 (AlphaFold model) |
>3E07_1 Protein spaetzle (chains A, B) VGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANF PQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTGLEHHHHHH
Biophysical Characterization of Refolded Drosophila Spatzle, a Cystine Knot Protein, Reveals Distinct Properties of Three Isoforms. Hoffmann, A., Funkner, A., Neumann, P. et al. J Biol Chem (2008) 283:32598-32609. DOI 10.1074/jbc.M801815200 · PubMed
Other PDB entries of the same protein (UniProt P48607 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3E07 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.