4BV4: Protein spaetzle C-106

Structure and allostery in Toll-Spatzle recognition. Determined by X-ray diffraction at 2.35 Å resolution. Released 4 Dec 2013.

Method: X-ray diffraction
Resolution: 2.35 Å
Organisms: DROSOPHILA MELANOGASTER, EPTATRETUS BURGERI
Chains: 3
Atoms: 4,830
Mol. weight: 77.02 kDa
Ligands: NAG
Released: 4 Dec 2013

Explore 4BV4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BV4 contains 18 α-helices and 36 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain L: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	12-17	6	1
β-strand	42-47	6	1
β-strand	53	1	2
α-helix	54	1
α-helix	57-59	3
α-helix	61	1
β-strand	65-75	11	2
β-strand	93-104	12	2

Chain M: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	2
β-strand	12-17	6	2
β-strand	42-47	6	2
α-helix	52	1
β-strand	53	1	1
α-helix	54	1
β-strand	65-75	11	1
β-strand	94-104	11	1

Chain R: 13 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	31-35	5
α-helix	38-40	3
β-strand	44-48	5	3
β-strand	51-56	6	3
β-strand	65-70	6	3
β-strand	74-79	6	3
α-helix	84-89	6
α-helix	91	1
β-strand	97-98	2	4
β-strand	101-105	5	3
α-helix	107-109	3
α-helix	116-121	6
β-strand	124-125	2	4
β-strand	129-133	5	3
α-helix	143-146	4
β-strand	154-158	5	3
β-strand	178-182	5	3
α-helix	190-193	4
β-strand	201-203	3	3
α-helix	212-213	2
α-helix	216-219	4
β-strand	225-227	3	3
α-helix	238-241	4
β-strand	249-251	3	3
β-strand	273-275	3	3
β-strand	297-300	4	3
β-strand	323-326	4	3
β-strand	346-348	3	3
β-strand	370-372	3	3
β-strand	394-396	3	3
β-strand	418-420	3	3
β-strand	426	1	5
α-helix	434-442	9
β-strand	447-448	2	3
β-strand	452	1	6
β-strand	453	1	5
β-strand	459	1	6
α-helix	460-462	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein spaetzle C-106	L, M	protein	107	DROSOPHILA MELANOGASTER	P48607 (AlphaFold model)
Protein toll, variable lymphocyte receptor B chimera	R	protein	446	DROSOPHILA MELANOGASTER, EPTATRETUS BURGERI	P08953 (AlphaFold model), Q4G1L2 (AlphaFold model)

Sequence of entity 1 (L, M), FASTA

>4BV4_1 PROTEIN SPAETZLE C-106 (chains L, M)
GVGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAAN
FPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG

Sequence of entity 2 (R), FASTA

>4BV4_2 PROTEIN TOLL, VARIABLE LYMPHOCYTE RECEPTOR B CHIMERA (chains R)
SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDY
QQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLD
RLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSN
KLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAH
LTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLR
AELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFA
HTTNLTDLRLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKE
QGSAKCSGSGKPVRSIICPTTGENLY

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Cytokine Spatzle Binds to the Drosophila Immunoreceptor Toll with a Neurotrophin-Like Specificity and Couples Receptor Activation. Lewis, M., Arnot, C.J., Beeston, H. et al. Proc Natl Acad Sci U S A (2013) 110:20461. DOI 10.1073/PNAS.1317002110 · PubMed

Other PDB entries of the same protein (UniProt P48607 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LXR 2.2 Å, Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and…
3E07 2.4 Å, Crystal structure of spatzle cystine knot
4LXS 3.3 Å, Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and…

Browse structure collections

About this viewer

MolViewer shows 4BV4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.