4LXR: Protein toll

Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and innate immunity. Determined by X-ray diffraction at 2.2 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Drosophila melanogaster
Chains: 3
Atoms: 7,862
Mol. weight: 119.56 kDa
Ligands: NAG
Released: 9 Apr 2014

Explore 4LXR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4LXR contains 33 α-helices and 58 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 45 β-strands

Element	Residues	Length	Sheet
α-helix	31-39	9
β-strand	44-48	5	1
β-strand	51-56	6	1
β-strand	65-70	6	1
β-strand	72-79	8	1
α-helix	84-89	6
α-helix	91	1
β-strand	97-98	2	2
β-strand	99-105	7	1
α-helix	107-109	3
α-helix	115-121	7
β-strand	124-125	2	2
β-strand	129-133	5	1
α-helix	143-146	4
β-strand	154-158	5	1
β-strand	178-182	5	1
α-helix	190-193	4
β-strand	201-203	3	1
α-helix	212-213	2
α-helix	217-219	3
β-strand	225-227	3	1
α-helix	238-241	4
β-strand	249-251	3	1
β-strand	273-275	3	1
β-strand	297-300	4	1
β-strand	323-326	4	1
β-strand	346-348	3	1
β-strand	370-372	3	1
β-strand	394-396	3	1
β-strand	404-405	2	3
β-strand	418-420	3	1
β-strand	428-429	2	3
β-strand	442-444	3	1
α-helix	456-460	5
α-helix	468-471	4
β-strand	477-479	3	1
α-helix	490-494	5
β-strand	501-503	3	1
β-strand	511-512	2	4
α-helix	514-517	4
β-strand	526-528	3	1
β-strand	536-537	2	4
β-strand	554-557	4	1
β-strand	563-564	2	5
α-helix	567-569	3
α-helix	570-576	7
α-helix	584-586	3
β-strand	588-591	4	1
β-strand	596	1	6
β-strand	597-599	3	5
β-strand	607	1	6
α-helix	608-610	3
α-helix	613-615	3
β-strand	617-619	3	7
β-strand	636-640	5	7
β-strand	645-649	5	7
α-helix	658-665	8
β-strand	670-674	5	7
α-helix	691-693	3
β-strand	696-698	3	7
α-helix	709-711	3
β-strand	718-720	3	7
α-helix	731-737	7
β-strand	745-747	3	7
β-strand	753	1	8
α-helix	757-759	3
α-helix	760-767	8
β-strand	773	1	7
α-helix	776-778	3
β-strand	780-781	2	8
β-strand	788-789	2	8
α-helix	790-792	3
α-helix	795-798	4

Chain J: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	9
β-strand	12-16	5	10
β-strand	43-47	5	10
β-strand	53	1	11
α-helix	54	1
α-helix	57-59	3
β-strand	65-73	9	11
β-strand	95-105	11	11

Chain K: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	11
β-strand	12-16	5	12
β-strand	43-47	5	12
α-helix	52	1
β-strand	53	1	13
α-helix	54	1
α-helix	62-64	3
β-strand	67-73	7	13
β-strand	95-102	8	13
β-strand	103	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein toll	A	protein	783	Drosophila melanogaster	P08953 (AlphaFold model)
Protein spaetzle C-106	J, K	protein	114	Drosophila melanogaster	P48607 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4LXR_1 Protein toll (chains A)
SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDY
QQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLD
RLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSN
KLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPHDVFAH
LTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRLR
AELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFA
HTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDH
NDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYN
NISSLGYEDLAFLSQNRLHVNMTHNKIRRIALPEDVHLGEGYNNNLVHVDLNDNPLVCDC
TILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPR
ERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQLMELHLENNTLLRLPSAN
TPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNRTMKWRSVK
LSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVNAEMPTRMVELSTNDICPAETGHHH
HHH

Sequence of entity 2 (J, K), FASTA

>4LXR_2 Protein spaetzle C-106 (chains J, K)
VGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANF
PQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTGLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6

Water and common crystallization additives (EPE) are not listed.

Primary citation

Structure of the Toll-Spatzle complex, a molecular hub in Drosophila development and innate immunity. Parthier, C., Stelter, M., Ursel, C. et al. Proc Natl Acad Sci U S A (2014) 111:6281-6286. DOI 10.1073/pnas.1320678111 · PubMed

Other PDB entries of the same protein (UniProt P08953 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BV4 2.35 Å, Structure and allostery in Toll-Spatzle recognition
4ARN 2.41 Å, Crystal structure of the N-terminal domain of Drosophila Toll receptor
4ARR 3.0 Å, Crystal structure of the N-terminal domain of Drosophila Toll receptor with the magic…
4LXS 3.3 Å, Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and…

Browse structure collections

About this viewer

MolViewer shows 4LXR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.