3E1R: Centrosomal protein of 55 kDa

Midbody targeting of the ESCRT machinery by a non-canonical coiled-coil in CEP55. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Nov 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 971
Mol. weight: 15.12 kDa
Released: 4 Nov 2008

Explore 3E1R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3E1R contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	166-209	44

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	169-207	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Centrosomal protein of 55 kDa	A, B	protein	58	Homo sapiens	Q53EZ4 (AlphaFold model)
Programmed cell death 6-interacting protein	C	protein	13		Q8WUM4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3E1R_1 Centrosomal protein of 55 kDa (chains A, B)
FNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETAAHSLP

Sequence of entity 2 (C), FASTA

>3E1R_2 Programmed cell death 6-interacting protein (chains C)
QAQGPPYPTYPGY

Primary citation

Midbody targeting of the ESCRT machinery by a noncanonical coiled coil in CEP55. Lee, H.H., Elia, N., Ghirlando, R. et al. Science (2008) 322:576-580. DOI 10.1126/science.1162042 · PubMed

Other PDB entries of the same protein (UniProt Q53EZ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WUT 2.3 Å, Structure basis of inactivating cell abscission
3WUV 2.79 Å, Structure basis of inactivating cell abscission with chimera peptide 2
3WUU 2.9 Å, Structure basis of inactivating cell abscission with chimera peptide 1

Browse structure collections

About this viewer

MolViewer shows 3E1R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.