3WUV: Centrosomal protein of 55 kDa
Structure basis of inactivating cell abscission with chimera peptide 2. Determined by X-ray diffraction at 2.79 Å resolution. Released 15 Jul 2015.
- Method
- X-ray diffraction
- Resolution
- 2.79 Å
- Organism
- Homo sapiens
- Chains
- 18
- Atoms
- 6,299
- Mol. weight
- 96.18 kDa
- Released
- 15 Jul 2015
Explore 3WUV in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3WUV contains 12 α-helices and 0 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 159-205 | 47 | |
Chain B: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 158-205 | 48 | |
Chains D and G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 162-207 | 46 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 161-207 | 47 | |
Chains H and Q: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 158-208 | 51 | |
Chains J and N: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 158-207 | 50 | |
Chain K: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 158-209 | 52 | |
Chain M: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 159-209 | 51 | |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Centrosomal protein of 55 kDa | A, B, D, E, G, H, J, K, M, N, P, Q | protein | 63 | Homo sapiens | Q53EZ4 (AlphaFold model) |
| peptide from Programmed cell death 6-interacting protein | C, F, I, L, O, R | protein | 14 | Homo sapiens | Q8WUM4 (AlphaFold model) |
Sequence of entity 1 (A, B, D, E, G, H, J, K, M, N, P, Q), FASTA
>3WUV_1 Centrosomal protein of 55 kDa (chains A, B, D, E, G, H, J, K, M, N, P, Q)
GAMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETAAH
SLP
Sequence of entity 2 (C, F, I, L, O, R), FASTA
>3WUV_2 peptide from Programmed cell death 6-interacting protein (chains C, F, I, L, O, R)
DQAQGPPYPTYIPP
Primary citation
Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells. Kim, H.J., Yoon, J., Matsuura, A. et al. Proc Natl Acad Sci U S A (2015) 112:12372-12377. DOI 10.1073/pnas.1418606112 · PubMed
Other PDB entries of the same protein (UniProt Q53EZ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3E1R 2.0 Å, Midbody targeting of the ESCRT machinery by a non-canonical coiled-coil in CEP55
- 3WUT 2.3 Å, Structure basis of inactivating cell abscission
- 3WUU 2.9 Å, Structure basis of inactivating cell abscission with chimera peptide 1
Browse structure collections
About this viewer
MolViewer shows 3WUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.