3E8C: Kinase domain of PKA
Crystal structures of the kinase domain of PKA in complex with ATP-competitive inhibitors. Determined by X-ray diffraction at 2.2 Å resolution. Released 18 Nov 2008.
- Method
- X-ray diffraction
- Resolution
- 2.2 Å
- Organism
- Bos taurus
- Chains
- 12
- Atoms
- 18,893
- Mol. weight
- 260.85 kDa
- Ligands
- G96
- Released
- 18 Nov 2008
Explore 3E8C in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
3E8C contains 133 α-helices and 84 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 20 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-31 | 21 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-52 | 10 | 1 |
| β-strand | 55-62 | 8 | 1 |
| β-strand | 68-75 | 8 | 1 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-97 | 13 | |
| β-strand | 103 | 1 | 2 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-111 | 6 | 1 |
| β-strand | 115-120 | 6 | 1 |
| β-strand | 127 | 1 | 2 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 3 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 2 |
| β-strand | 180-182 | 3 | 2 |
| β-strand | 189-190 | 2 | 3 |
| β-strand | 195 | 1 | 4 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-210 | 4 | |
| β-strand | 215 | 1 | 4 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 277-279 | 3 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 | |
| α-helix | 316-318 | 3 | |
| α-helix | 336-338 | 3 | |
Chain B: 20 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-31 | 19 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-52 | 10 | 5 |
| β-strand | 55-62 | 8 | 5 |
| β-strand | 68-75 | 8 | 5 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-95 | 11 | |
| β-strand | 103 | 1 | 6 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-111 | 6 | 5 |
| β-strand | 115-120 | 6 | 5 |
| β-strand | 127 | 1 | 6 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 7 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 6 |
| β-strand | 180-182 | 3 | 6 |
| β-strand | 189-190 | 2 | 7 |
| β-strand | 195 | 1 | 8 |
| β-strand | 200 | 1 | 9 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-210 | 4 | |
| β-strand | 215 | 1 | 8 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 277-279 | 3 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 | |
| α-helix | 316-318 | 3 | |
| α-helix | 336-338 | 3 | |
Chain C: 21 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-31 | 21 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-52 | 10 | 10 |
| β-strand | 55-62 | 8 | 10 |
| β-strand | 68-75 | 8 | 10 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-95 | 11 | |
| β-strand | 103 | 1 | 11 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-111 | 6 | 10 |
| β-strand | 115-120 | 6 | 10 |
| β-strand | 127 | 1 | 11 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 12 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 11 |
| β-strand | 180-182 | 3 | 11 |
| β-strand | 189-190 | 2 | 12 |
| β-strand | 195 | 1 | 13 |
| β-strand | 200 | 1 | 14 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-210 | 4 | |
| β-strand | 215 | 1 | 13 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 277-279 | 3 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 | |
| α-helix | 316-318 | 3 | |
| α-helix | 336-338 | 3 | |
| α-helix | 341-342 | 2 | |
Chain D: 20 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-31 | 21 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-52 | 10 | 15 |
| β-strand | 55-62 | 8 | 15 |
| β-strand | 68-75 | 8 | 15 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-95 | 11 | |
| β-strand | 103 | 1 | 16 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-111 | 6 | 15 |
| β-strand | 115-120 | 6 | 15 |
| β-strand | 127 | 1 | 16 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 17 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 16 |
| β-strand | 180-182 | 3 | 16 |
| β-strand | 189-190 | 2 | 17 |
| β-strand | 195 | 1 | 18 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-210 | 4 | |
| β-strand | 215 | 1 | 18 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 277-279 | 3 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 | |
| α-helix | 316-318 | 3 | |
| α-helix | 336-338 | 3 | |
Chain E: 20 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-31 | 15 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-52 | 10 | 19 |
| β-strand | 55-62 | 8 | 19 |
| β-strand | 68-75 | 8 | 19 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-95 | 11 | |
| β-strand | 103 | 1 | 20 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-111 | 6 | 19 |
| β-strand | 115-120 | 6 | 19 |
| β-strand | 127 | 1 | 20 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 21 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 20 |
| β-strand | 180-182 | 3 | 20 |
| β-strand | 189-190 | 2 | 21 |
| β-strand | 195 | 1 | 22 |
| β-strand | 200 | 1 | 23 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-210 | 4 | |
| β-strand | 215 | 1 | 22 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 277-279 | 3 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 | |
| α-helix | 316-318 | 3 | |
| α-helix | 336-338 | 3 | |
Chain F: 21 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-31 | 22 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-52 | 10 | 24 |
| β-strand | 55-62 | 8 | 24 |
| β-strand | 68-75 | 8 | 24 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-95 | 11 | |
| β-strand | 103 | 1 | 25 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-111 | 6 | 24 |
| β-strand | 115-120 | 6 | 24 |
| β-strand | 127 | 1 | 25 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 26 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 25 |
| β-strand | 180-182 | 3 | 25 |
| β-strand | 189-190 | 2 | 26 |
| β-strand | 195 | 1 | 27 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-210 | 4 | |
| β-strand | 215 | 1 | 27 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 277-279 | 3 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 | |
| α-helix | 316-318 | 3 | |
| α-helix | 336-338 | 3 | |
| α-helix | 341-342 | 2 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-12 | 7 | |
Chains H and K: 2 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-12 | 7 | |
| α-helix | 18-21 | 4 | |
| β-strand | 22 | 1 | 9 |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| cAMP-dependent protein kinase catalytic subunit alpha | A, B, C, D, E, F | protein | 350 | Bos taurus | P00517 (AlphaFold model) |
| cAMP-dependent protein kinase inhibitor peptide | G, H, I, J, K, L | protein | 20 | | Q3SX13 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>3E8C_1 cAMP-dependent protein kinase catalytic subunit alpha (chains A, B, C, D, E, F)
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLV
KHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVM
EYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYI
QVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT
DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Sequence of entity 2 (G, H, I, J, K, L), FASTA
>3E8C_2 cAMP-dependent protein kinase inhibitor peptide (chains G, H, I, J, K, L)
TTYADFIASGRTGRRNAIHD
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| G96 | 4-[2-(4-amino-1,2,5-oxadiazol-3-yl)-6-{[(2R)-2-amino-3-phenylpropyl]oxy}-1-ethy… | C24 H27 N7 O3 | 6 |
Primary citation
Aminofurazans as potent inhibitors of AKT kinase. Rouse, M.B., Seefeld, M.A., Leber, J.D. et al. Bioorg Med Chem Lett (2009) 19:1508-1511. DOI 10.1016/j.bmcl.2009.01.002 · PubMed
Other PDB entries of the same protein (UniProt P00517 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4Z84 1.55 Å, PKAB3 in complex with pyrrolidine inhibitor 34a
- 4C38 1.58 Å, PKA-S6K1 Chimera with compound 21e (CCT239066) bound
- 1XH8 1.6 Å, Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein…
- 5VHB 1.61 Å, Crystal structure of Protein Kinase A in complex with the PKI peptide and…
- 1XH9 1.64 Å, Crystal Structures of Protein Kinase B Selective Inhibitors in Complex with Protein…
- 3ZO4 1.65 Å, The Synthesis and Evaluation of Diazaspirocyclic Protein Kinase Inhibitors
- 4C33 1.7 Å, PKA-S6K1 Chimera Apo
- 4C37 1.7 Å, PKA-S6K1 Chimera with compound 21a (CCT196539) bound
- 8SF8 1.7 Å, Structure of bovine PKA bound to (R)-N-(4-(1H-pyrrolo[2,3-b]pyridin-4-yl)phenyl)-2-amino-…
- 4C34 1.78 Å, PKA-S6K1 Chimera with Staurosporine bound
- 3KKV 1.8 Å, Structure of PKA with a protein Kinase B-selective inhibitor.
- 4Z83 1.8 Å, PKAB3 in complex with pyrrolidine inhibitor 47a
Browse structure collections
About this viewer
MolViewer shows 3E8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.