3EG3: N114A mutant of ABL-SH3 domain

Crystal structure of the N114A mutant of ABL-SH3 domain. Determined by X-ray diffraction at 1.4 Å resolution. Released 15 Sept 2009.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 546
Mol. weight: 7.06 kDa
Released: 15 Sept 2009

Explore 3EG3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EG3 contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	1
β-strand	72	1	2
β-strand	79	1	1
β-strand	82	1	2
β-strand	87-93	7	1
β-strand	99-104	6	1
β-strand	107-112	6	1
α-helix	113-115	3
β-strand	116-118	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proto-oncogene tyrosine-protein kinase ABL1	A	protein	63	Homo sapiens	P00519 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EG3_1 Proto-oncogene tyrosine-protein kinase ABL1 (chains A)
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITP
VNS

Primary citation

Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl. Palencia, A., Camara-Artigas, A., Pisabarro, M.T. et al. J Biol Chem (2010) 285:2823-2833. DOI 10.1074/jbc.M109.048033 · PubMed

Other PDB entries of the same protein (UniProt P00519 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OAZ 1.03 Å, Crystal structure of the Abl-SH3 domain at pH 7.5
7PVS 1.05 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
4J9C 1.05 Å, Crystal structure of the Abl-SH3 domain H59Q-N96T mutant complexed with the designed…
4J9F 1.09 Å, Crystal structure of the Abl-SH3 domain complexed with the high affinity peptide P0
7PW2 1.1 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E mutant
4J9E 1.4 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
4J9D 1.5 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5HU9 1.53 Å, Crystal structure of ABL1 in complex with CHMFL-074
7PVQ 1.55 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
4JJC 1.6 Å, Crystal structure of the Abl-SH3 domain at pH5

Browse structure collections

About this viewer

MolViewer shows 3EG3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.