4J9D: N114A mutant of the Abl-SH3 domain

Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high affinity peptide P0. Determined by X-ray diffraction at 1.5 Å resolution. Released 29 Jan 2014.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 6
Atoms: 1,805
Mol. weight: 24.22 kDa
Released: 29 Jan 2014

Explore 4J9D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4J9D contains 6 α-helices and 26 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	66-68	3	1
β-strand	72	1	2
β-strand	79	1	3
β-strand	82	1	2
β-strand	87-88	2	1
β-strand	89-93	5	3
β-strand	99-104	6	3
β-strand	107-112	6	3
α-helix	113-115	3
β-strand	116-118	3	1

Chains B, D and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5

Chain E: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	7
β-strand	72	1	8
β-strand	79	1	7
β-strand	82	1	8
β-strand	87-93	7	7
β-strand	99-104	6	7
β-strand	107-112	6	7
α-helix	113-115	3
β-strand	116-118	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase ABL1	A, C, E	protein	63	Homo sapiens	P00519 (AlphaFold model)
P0	B, D, F	protein	11		Q9Y3L3 (AlphaFold model)

Sequence of entity 1 (A, C, E), FASTA

>4J9D_1 Tyrosine-protein kinase ABL1 (chains A, C, E)
MENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITP
VNS

Sequence of entity 2 (B, D, F), FASTA

>4J9D_2 P0 (chains B, D, F)
XAPTYPPPLPP

Primary citation

Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high affinity peptide P0. Camara-Artigas, A. To be published.

Other PDB entries of the same protein (UniProt P00519 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OAZ 1.03 Å, Crystal structure of the Abl-SH3 domain at pH 7.5
7PVS 1.05 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
4J9C 1.05 Å, Crystal structure of the Abl-SH3 domain H59Q-N96T mutant complexed with the designed…
4J9F 1.09 Å, Crystal structure of the Abl-SH3 domain complexed with the high affinity peptide P0
7PW2 1.1 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E mutant
3EG3 1.4 Å, Crystal structure of the N114A mutant of ABL-SH3 domain
4J9E 1.4 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
5HU9 1.53 Å, Crystal structure of ABL1 in complex with CHMFL-074
7PVQ 1.55 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
4JJC 1.6 Å, Crystal structure of the Abl-SH3 domain at pH5

Browse structure collections

About this viewer

MolViewer shows 4J9D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.