7PVS: Tyrosine-protein kinase ABL1

Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E mutant in presence of PEG 200. Determined by X-ray diffraction at 1.05 Å resolution. Released 14 Sept 2022.

Method: X-ray diffraction
Resolution: 1.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,166
Mol. weight: 14.15 kDa
Released: 14 Sept 2022

Explore 7PVS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PVS contains 3 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	1
β-strand	72	1	2
β-strand	79	1	1
β-strand	82	1	2
β-strand	87-93	7	1
β-strand	99-104	6	1
β-strand	107-112	6	1
α-helix	113-115	3
β-strand	116-118	3	1

Chain B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	3
β-strand	72	1	4
β-strand	79	1	3
α-helix	80-81	2
β-strand	82	1	4
β-strand	87-93	7	3
β-strand	99-104	6	3
β-strand	107-112	6	3
α-helix	113-115	3
β-strand	116-118	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase ABL1	A, B	protein	59	Homo sapiens	P00519 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7PVS_1 Tyrosine-protein kinase ABL1 (chains A, B)
GPNLFVALYDFESRTENTLSITKGEKLRVLNNTENGEWCEAQTKNGQGWVPSNYITPVN

Primary citation

Understanding domain swapping in the c-Src SH3 domain through hinge-loop mutagenesis. Salinas-Garcia, M.C., Plaza-Garrido, M., Martinez, J.C. et al. Acta Crystallogr D Struct Biol (2025). DOI 10.1107/S2059798325006977 · PubMed

Other PDB entries of the same protein (UniProt P00519 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OAZ 1.03 Å, Crystal structure of the Abl-SH3 domain at pH 7.5
4J9C 1.05 Å, Crystal structure of the Abl-SH3 domain H59Q-N96T mutant complexed with the designed…
4J9F 1.09 Å, Crystal structure of the Abl-SH3 domain complexed with the high affinity peptide P0
7PW2 1.1 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E mutant
3EG3 1.4 Å, Crystal structure of the N114A mutant of ABL-SH3 domain
4J9E 1.4 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
4J9D 1.5 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5HU9 1.53 Å, Crystal structure of ABL1 in complex with CHMFL-074
7PVQ 1.55 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
4JJC 1.6 Å, Crystal structure of the Abl-SH3 domain at pH5

Browse structure collections

About this viewer

MolViewer shows 7PVS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.