3EJ8: Nitric oxide synthase, inducible

Structure of double mutant of human iNOS oxygenase domain with bound immidazole. Determined by X-ray diffraction at 2.55 Å resolution. Released 7 Oct 2008.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 4
Atoms: 14,119
Mol. weight: 199.97 kDa
Ligands: HEC, H4B, ZN
Released: 7 Oct 2008

Explore 3EJ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EJ8 contains 103 α-helices and 116 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	85-88	4	1
β-strand	89	1	2
β-strand	95-98	4	1
α-helix	100-103	4
β-strand	111	1	3
β-strand	114	1	3
β-strand	115	1	4
α-helix	123-125	3
β-strand	126	1	5
α-helix	136-152	17
α-helix	159-176	18
α-helix	183-195	13
α-helix	203-205	3
β-strand	210-213	4	6
α-helix	220-235	16
α-helix	236-238	3
β-strand	243-246	4	6
α-helix	248-250	3
β-strand	258-259	2	7
β-strand	263	1	6
β-strand	267	1	8
β-strand	269-271	3	9
β-strand	277-279	3	9
α-helix	281-283	3
α-helix	284-292	9
α-helix	295-297	3
β-strand	304	1	8
α-helix	305-306	2
β-strand	307-310	4	7
α-helix	314-316	3
β-strand	317-319	3	7
α-helix	320-322	3
α-helix	323-325	3
β-strand	328-330	3	10
α-helix	339-342	4
β-strand	345-347	3	10
β-strand	351-352	2	6
β-strand	356-359	4	11
β-strand	362-364	3	11
β-strand	369-370	2	6
β-strand	373-374	2	12
α-helix	375-376	2
α-helix	377-382	6
α-helix	392-399	8
α-helix	406-408	3
α-helix	410-428	19
β-strand	433-434	2	12
α-helix	436-454	19
α-helix	461-464	4
α-helix	470-472	3
α-helix	474-477	4
β-strand	478	1	2
β-strand	482	1	13
β-strand	488-490	3	11
β-strand	491	1	5
α-helix	495-498	4

Chain B: 24 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	85-88	4	14
β-strand	89	1	15
β-strand	95-98	4	14
α-helix	100-103	4
β-strand	111	1	16
β-strand	114	1	16
β-strand	115	1	13
β-strand	126	1	17
α-helix	133-135	3
α-helix	136-151	16
α-helix	159-176	18
α-helix	183-195	13
α-helix	203-205	3
β-strand	210-213	4	18
α-helix	220-235	16
α-helix	236-238	3
β-strand	243-246	4	18
β-strand	258-259	2	19
β-strand	263	1	18
β-strand	267	1	20
β-strand	269-271	3	21
β-strand	277-279	3	21
α-helix	281-283	3
α-helix	284-292	9
β-strand	304	1	20
α-helix	305-306	2
β-strand	307-310	4	19
α-helix	314-316	3
β-strand	317-319	3	19
β-strand	328-330	3	22
α-helix	339-342	4
β-strand	345-347	3	22
β-strand	351-352	2	18
β-strand	356-359	4	23
β-strand	362-364	3	23
β-strand	369-370	2	18
β-strand	374	1	24
α-helix	375-376	2
α-helix	377-382	6
α-helix	383-384	2
α-helix	392-398	7
α-helix	406-408	3
α-helix	410-428	19
β-strand	434	1	24
α-helix	436-454	19
β-strand	458	1	25
α-helix	461-464	4
α-helix	470-472	3
α-helix	474-477	4
β-strand	478	1	15
β-strand	481	1	25
β-strand	482	1	4
β-strand	488-490	3	23
β-strand	491	1	17
α-helix	495-498	4

Chain C: 25 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	85-88	4	26
β-strand	89	1	27
β-strand	95-98	4	26
α-helix	100-102	3
β-strand	115	1	28
α-helix	123-125	3
β-strand	126	1	29
α-helix	133-135	3
α-helix	136-151	16
α-helix	159-176	18
α-helix	183-195	13
α-helix	203-205	3
β-strand	210-213	4	30
α-helix	220-235	16
α-helix	236-238	3
β-strand	243-246	4	30
α-helix	248-250	3
β-strand	258-259	2	31
β-strand	263	1	30
β-strand	267	1	32
β-strand	269-271	3	33
β-strand	277-279	3	33
α-helix	281-283	3
α-helix	284-291	8
β-strand	304	1	32
α-helix	305-306	2
β-strand	307-310	4	31
α-helix	314-316	3
β-strand	317-319	3	31
α-helix	323-325	3
β-strand	328-330	3	34
α-helix	340-342	3
β-strand	345-347	3	34
β-strand	351-352	2	30
β-strand	356-359	4	35
β-strand	362-364	3	35
β-strand	369-370	2	30
β-strand	374	1	36
α-helix	375-376	2
α-helix	377-382	6
α-helix	392-399	8
α-helix	406-408	3
α-helix	410-428	19
β-strand	434	1	36
α-helix	436-453	18
α-helix	461-464	4
α-helix	474-477	4
β-strand	478	1	27
β-strand	482	1	37
β-strand	488-490	3	35
β-strand	491	1	29
α-helix	495-498	4

Chain D: 27 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	85-88	4	38
β-strand	89	1	39
β-strand	95-98	4	38
α-helix	100-102	3
β-strand	105	1	40
β-strand	115	1	37
α-helix	123-125	3
β-strand	126	1	41
α-helix	136-151	16
α-helix	159-176	18
α-helix	183-195	13
α-helix	203-205	3
β-strand	210-213	4	42
α-helix	220-235	16
α-helix	236-238	3
β-strand	243-246	4	42
α-helix	247-250	4
β-strand	258-259	2	43
β-strand	263	1	42
β-strand	267	1	44
β-strand	269-271	3	45
β-strand	277-279	3	45
α-helix	284-292	9
α-helix	295-297	3
β-strand	304	1	44
α-helix	305-306	2
β-strand	307-310	4	43
α-helix	314-316	3
β-strand	317-319	3	43
α-helix	320-322	3
α-helix	323-325	3
β-strand	328-330	3	46
α-helix	339-342	4
β-strand	345-347	3	46
β-strand	351-352	2	42
β-strand	356-359	4	47
β-strand	362-364	3	47
β-strand	369-370	2	42
β-strand	373-374	2	48
α-helix	375-376	2
α-helix	377-382	6
α-helix	383-384	2
α-helix	392-398	7
α-helix	406-408	3
α-helix	410-428	19
β-strand	433-434	2	48
α-helix	436-454	19
α-helix	461-464	4
α-helix	470-472	3
α-helix	474-477	4
β-strand	478	1	39
β-strand	482	1	28
β-strand	484	1	40
β-strand	488-490	3	47
β-strand	491	1	41
α-helix	495-498	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nitric oxide synthase, inducible	A, B, C, D	protein	424	Homo sapiens	P35228 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3EJ8_1 Nitric oxide synthase, inducible (chains A, B, C, D)
PRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLP
QAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCI
GRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQRSDGKHDFRVWN
AQLIRYAGYQMPDGSIRGDPANVEITQLCIDLGWKPKYGRFDVLPLVLQANGRDPELFEI
PPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTEIGVR
DFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINIAVLHSFQKQNVTIMDHHSAAE
SFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEMLNYVLSPFYYYQVEAWKTHVW
QDEK

Ligands and cofactors

ID	Name	Formula	Copies
HEC	Heme C	C34 H36 Fe N4 O4	4
H4B	5,6,7,8-tetrahydrobiopterin	C9 H15 N5 O3	4
ZN	Zinc ion	Zn	2

Water and common crystallization additives (IMD) are not listed.

Primary citation

Anchored plasticity opens doors for selective inhibitor design in nitric oxide synthase. Garcin, E.D., Arvai, A.S., Rosenfeld, R.J. et al. Nat Chem Biol (2008) 4:700-707. DOI 10.1038/nchembio.115 · PubMed

Other PDB entries of the same protein (UniProt P35228 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JWM 1.23 Å, Crystal structure of the SPRY domain of SPSB2 in complex with cR7, a potent cyclic…
6KEY 1.24 Å, Structural basis for the regulation of inducible nitric oxide synthase (iNOS) by the…
5XN3 1.34 Å, Crystal structure of SPSB2 in complex with a rational designed RGD containing cyclic…
6JWN 1.61 Å, Crystal structure of the SPRY domain of SPSB2 in complex with cR9, a cyclic peptide…
3E7G 2.2 Å, Structure of human INOSOX with inhibitor AR-C95791
4NOS 2.25 Å, Human inducible nitric oxide synthase with inhibitor
3HR4 2.5 Å, Human iNOS Reductase and Calmodulin Complex
1NSI 2.55 Å, Human inducible nitric oxide synthase, ZN-bound, L-arg complex
2NSI 3.0 Å, Human inducible nitric oxide synthase, ZN-free, seitu complex
4CX7 3.16 Å, Structure of human iNOS heme domain in complex with (R)-6-(3-AMINO-2-(5-(2-(6-AMINO-4-…
2LL6 Solution NMR structure of CaM bound to iNOS CaM binding domain peptide
5TP6 Solution structure of the CaM34 with the iNOS CaM binding domain peptide

Browse structure collections

About this viewer

MolViewer shows 3EJ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.