5TP6: CaM34 with the iNOS CaM binding domain peptide

Solution structure of the CaM34 with the iNOS CaM binding domain peptide. Determined by solution NMR. Released 27 Sept 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,395
Mol. weight: 20.04 kDa
Released: 27 Sept 2017

Explore 5TP6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TP6 contains 13 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-19	14
β-strand	27-28	2	1
α-helix	29-36	8
α-helix	37-39	3
α-helix	46-54	9
β-strand	62-63	2	1
α-helix	65-68	4
α-helix	74-77	4
α-helix	81-84	4
α-helix	87-90	4
α-helix	104-112	9
α-helix	118-126	9
α-helix	138-146	9

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	520-523	4
α-helix	525-527	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin	A	protein	148	Homo sapiens	P0DP23 (AlphaFold model)
Nitric oxide synthase, inducible	B	protein	29	Homo sapiens	P35228 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TP6_1 Calmodulin (chains A)
ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGN
GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFAKDGNGYISAAELRHVMTNLGEKLTDEE
VDEMIREAAIDGDGQVNYEEFVQMMTAK

Sequence of entity 2 (B), FASTA

>5TP6_2 Nitric oxide synthase, inducible (chains B)
AGHMRPKRREIPLKVLVKAVLFACMLMRK

Primary citation

Structural Consequences of Calmodulin EF Hand Mutations. Piazza, M., Taiakina, V., Dieckmann, T. et al. Biochemistry (2017) 56:944-956. DOI 10.1021/acs.biochem.6b01296 · PubMed

Other PDB entries of the same protein (UniProt P0DP23 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MXD 1.17 Å, Human E104A calmodulin:MLCK RM20 complex
7BF1 1.24 Å, Ca2+-Calmodulin in complex with peptide from brain-type creatine kinase in extended 1:2…
6XXX 1.25 Å, 1.25 Angstrom crystal structure of Ca/CaM A102V:RyR2 peptide complex
4DJC 1.35 Å, 1.35 A crystal structure of the NaV1.5 DIII-IV-Ca/CaM complex
7BF2 1.43 Å, Ca2+-Calmodulin in complex with human muscle form creatine kinase peptide in extended…
2F3Y 1.45 Å, Calmodulin/IQ domain complex
2W73 1.45 Å, High-resolution structure of the complex between calmodulin and a peptide from…
4LZX 1.5 Å, Complex of IQCG and Ca2+-free CaM
5V03 1.58 Å, A positive allosteric modulator binding pocket in SK2 ion channels is shared by Riluzole…
9MVW 1.58 Å, Crystal structure of S101F calmodulin - CaM:RM20 analog complex
2F3Z 1.6 Å, Calmodulin/IQ-AA domain complex
6M7H 1.6 Å, Structure of calmodulin with KN93

Browse structure collections

About this viewer

MolViewer shows 5TP6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.