Crystal structure of human placental aromatase cytochrome P450 in complex with androstenedione. Determined by X-ray diffraction at 2.9 Å resolution. Released 23 Dec 2008.
Explore 3EQM in 3D Show helices and sheets RCSB PDB PDBe
3EQM contains 24 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 51-52 | 2 | |
| α-helix | 57-68 | 12 | |
| α-helix | 70-80 | 11 | |
| β-strand | 84-88 | 5 | 1 |
| β-strand | 93-97 | 5 | 1 |
| α-helix | 100-108 | 9 | |
| α-helix | 110-112 | 3 | |
| α-helix | 119-125 | 7 | |
| α-helix | 138-151 | 14 | |
| α-helix | 155-172 | 18 | |
| α-helix | 175-177 | 3 | |
| β-strand | 179 | 1 | 2 |
| β-strand | 185 | 1 | 2 |
| α-helix | 187-203 | 17 | |
| α-helix | 210-227 | 18 | |
| α-helix | 232-235 | 4 | |
| α-helix | 238-240 | 3 | |
| α-helix | 242-267 | 26 | |
| α-helix | 272-274 | 3 | |
| α-helix | 278-287 | 10 | |
| α-helix | 293-324 | 32 | |
| α-helix | 326-340 | 15 | |
| α-helix | 344-345 | 2 | |
| α-helix | 347-349 | 3 | |
| α-helix | 354-366 | 13 | |
| β-strand | 373-376 | 4 | 1 |
| β-strand | 381-383 | 3 | 3 |
| β-strand | 386-388 | 3 | 3 |
| β-strand | 393-396 | 4 | 1 |
| α-helix | 398-404 | 7 | |
| α-helix | 415-418 | 4 | |
| α-helix | 440-455 | 16 | |
| β-strand | 458-462 | 5 | 2 |
| β-strand | 473-475 | 3 | 4 |
| β-strand | 479-481 | 3 | 4 |
| β-strand | 490-494 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome P450 19A1 | A | protein | 503 | Homo sapiens | P11511 (AlphaFold model) |
>3EQM_1 Cytochrome P450 19A1 (chains A) MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH PDETKNMLEMIFTPRNSDRCLEH
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
| ASD | 4-androstene-3-17-dione | C19 H26 O2 | 1 |
| PO4 | Phosphate ion | O4 P | 2 |
Structural basis for androgen specificity and oestrogen synthesis in human aromatase. Ghosh, D., Griswold, J., Erman, M. et al. Nature (2009) 457:219-223. DOI 10.1038/nature07614 · PubMed
Other PDB entries of the same protein (UniProt P11511 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3EQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.