4KQ8: Recombinant Human Cytochrome P450 Aromatase

Structure of Recombinant Human Cytochrome P450 Aromatase. Determined by X-ray diffraction at 3.29 Å resolution. Released 21 Aug 2013.

Method: X-ray diffraction
Resolution: 3.29 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,729
Mol. weight: 55.68 kDa
Ligands: HEM, PO4, ASD
Released: 21 Aug 2013

Explore 4KQ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4KQ8 contains 23 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	51-52	2
α-helix	57-68	12
α-helix	70-80	11
β-strand	84-88	5	1
β-strand	93-97	5	1
α-helix	100-108	9
α-helix	110-112	3
α-helix	119-125	7
α-helix	138-151	14
α-helix	155-172	18
α-helix	175-177	3
β-strand	179	1	2
β-strand	185	1	2
α-helix	187-203	17
α-helix	210-227	18
α-helix	232-235	4
α-helix	238-268	31
α-helix	278-287	10
α-helix	293-323	31
α-helix	326-339	14
α-helix	344-345	2
α-helix	347-349	3
α-helix	354-366	13
β-strand	373-376	4	1
β-strand	381-382	2	3
β-strand	387-388	2	3
β-strand	393-396	4	1
α-helix	398-404	7
α-helix	415-418	4
α-helix	433-435	3
α-helix	440-457	18
β-strand	458-462	5	2
β-strand	473-476	4	4
β-strand	478-481	4	4
β-strand	490-494	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cytochrome P450 19A1	A	protein	473	Homo sapiens	P11511 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4KQ8_1 Cytochrome P450 19A1 (chains A)
MAKKTSSKGRSSIPGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEET
LIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSG
PGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIV
VKIQGYFDAWQALLIKPDIFFKISWLYKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEE
CMDFATELILAEKRGDLTRENVNQCILEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIK
EIQTVIGERDIKIDDIQKLKVMENFIYESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNI
ILNIGRMHRLEFFPKPNEFTLENFAKNVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTL
LRRFHVKTLQGQCVESIQKIHDLSLHPDETKNMLEMIFTPRNSDRCLEHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1
PO4	Phosphate ion	O4 P	1
ASD	4-androstene-3-17-dione	C19 H26 O2	1

Primary citation

Structural basis for the functional roles of critical residues in human cytochrome p450 aromatase. Lo, J., Di Nardo, G., Griswold, J. et al. Biochemistry (2013) 52:5821-5829. DOI 10.1021/bi400669h · PubMed

Other PDB entries of the same protein (UniProt P11511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3S79 2.75 Å, Human placental aromatase cytochrome P450 (CYP19A1) refined at 2.75 angstrom
5JKV 2.75 Å, Human placental aromatase cytochrome P450 (CYP19A1) at 2.75 Å with bound polyethylene…
3EQM 2.9 Å, Crystal structure of human placental aromatase cytochrome P450 in complex with…
5JKW 3.0 Å, Human placental aromatase cytochrome P450 (CYP19A1) complexed with testosterone
5JL6 3.0 Å, Human placental aromatase cytochrome P450 (CYP19A1): androstenedione complex #2
5JL7 3.1 Å, Human placental aromatase cytochrome P450 (CYP19A1): androstenedione complex #3
5JL9 3.1 Å, Human placental aromatase cytochrome P450 (CYP19A1): androstenedione complex #4
3S7S 3.21 Å, Crystal structure of human placental aromatase complexed with breast cancer drug…
4GL5 3.48 Å, Structure of human placental aromatase complexed with designed inhibitor HDDG029…
4GL7 3.9 Å, Structure of human placental aromatase complexed with designed inhibitor HDDG046…

Browse structure collections

About this viewer

MolViewer shows 4KQ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.