3EQT: Human LGP2 C-terminal domain

Crystal structure of human LGP2 C-terminal domain in complex with dsRNA. Determined by X-ray diffraction at 2.0 Å resolution. Released 10 Mar 2009.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,721
Mol. weight: 38.68 kDa
Ligands: ZN
Released: 10 Mar 2009

Explore 3EQT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EQT contains 20 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	549-551	3
β-strand	553-556	4	1
β-strand	562-565	4	1
α-helix	566-568	3
β-strand	569-572	4	2
β-strand	576-579	4	2
α-helix	582-587	6
β-strand	588-594	7	2
α-helix	595-596	2
β-strand	604-612	9	2
β-strand	618-625	8	2
β-strand	628-633	6	2
α-helix	634	1
α-helix	635-637	3
β-strand	638-642	5	1
β-strand	645-647	3	1
α-helix	652-654	3
α-helix	660	1
β-strand	661	1	2
α-helix	662	1
α-helix	664-671	8

Chain B: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	549-551	3
β-strand	553-556	4	3
β-strand	562-565	4	3
α-helix	566-568	3
β-strand	569-572	4	4
β-strand	576-579	4	4
α-helix	582-587	6
β-strand	588-590	3	4
α-helix	594-596	3
β-strand	604-612	9	4
β-strand	618-625	8	4
β-strand	628-633	6	4
α-helix	635-637	3
β-strand	638-642	5	3
β-strand	645-647	3	3
α-helix	652-654	3
α-helix	658-660	3
β-strand	661	1	4
α-helix	662	1
α-helix	664-671	8
α-helix	675-677	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATP-dependent RNA helicase DHX58	A, B	protein	145	Homo sapiens	Q96C10 (AlphaFold model)
5'-r(gpcpgpcpgpcpgpc)-3'	C, D	RNA	8

Sequence of entity 1 (A, B), FASTA

>3EQT_1 ATP-dependent RNA helicase DHX58 (chains A, B)
ENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVP
DFDFLQHCAENLSDLSLDLEHHHHH

Sequence of entity 2 (C, D), FASTA

>3EQT_2 5'-R(*GP*CP*GP*CP*GP*CP*GP*C)-3' (chains C, D)
GCGCGCGC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The RIG-I-like Receptor LGP2 Recognizes the Termini of Double-stranded RNA. Li, X., Ranjith-Kumar, C.T., Brooks, M.T. et al. J Biol Chem (2009) 284:13881-13891. DOI 10.1074/jbc.M900818200 · PubMed

Other PDB entries of the same protein (UniProt Q96C10 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W4R 2.6 Å, Crystal structure of the regulatory domain of human LGP2
9LOV 3.07 Å, LGP2:MDA5:dsRNA filament
9LOU 3.36 Å, LGP2:dsRNA complex
2RQA Solution structure of LGP2 CTD

Browse structure collections

About this viewer

MolViewer shows 3EQT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.