3EU7: PALB2 / BRCA2 complex

Crystal Structure of a PALB2 / BRCA2 complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Jul 2009.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,585
Mol. weight: 41.49 kDa
Released: 28 Jul 2009

Explore 3EU7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EU7 contains 3 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	855-861	7	1
β-strand	869-876	8	2
β-strand	885-891	7	2
β-strand	894-900	7	2
β-strand	906-913	8	2
α-helix	918	1
β-strand	919-923	5	3
β-strand	932-936	5	3
β-strand	941-948	8	3
β-strand	957-972	16	3
β-strand	976-981	6	3
β-strand	988-994	7	3
β-strand	1000-1006	7	3
β-strand	1013-1018	6	4
β-strand	1019-1020	2	5
β-strand	1025-1030	6	4
β-strand	1034-1039	6	4
β-strand	1045-1050	6	4
β-strand	1060-1066	7	5
β-strand	1069-1075	7	5
β-strand	1090-1095	6	5
β-strand	1102-1108	7	5
β-strand	1118-1124	7	6
β-strand	1127-1132	6	6
β-strand	1137-1141	5	6
β-strand	1147-1151	5	6
α-helix	1152-1153	2
β-strand	1161-1164	4	1
β-strand	1170-1174	5	1
β-strand	1180-1185	6	1

Chain X: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	31-35	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Partner and localizer of BRCA2	A	protein	356	Homo sapiens	Q86YC2 (AlphaFold model)
19meric peptide from Breast cancer type 2 susceptibility protein	X	protein	19		P51587

Sequence of entity 1 (A), FASTA

>3EU7_1 Partner and localizer of BRCA2 (chains A)
GPHMSVEQTETAELPASDSINPGNLQLVSELKNPSGSCSVDVSAMFWERAGCKEPCIITA
CEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCS
SDDESEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPE
ETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDSYQASVCHKAYSEMGLL
FIVLSHPCAKESESLRSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAA
ILTSGTIAIWDLLLGQCTALLPPVSDQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS

Sequence of entity 2 (X), FASTA

>3EU7_2 19meric peptide from Breast cancer type 2 susceptibility protein (chains X)
KADLGPISLNWFEELSSEA

Primary citation

Structural basis for recruitment of BRCA2 by PALB2. Oliver, A.W., Swift, S., Lord, C.J. et al. EMBO Rep (2009) 10:990-996. DOI 10.1038/embor.2009.126 · PubMed

Other PDB entries of the same protein (UniProt Q86YC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W18 1.9 Å, Crystal structure of the C-terminal WD40 domain of human PALB2
7S4A 2.69 Å, MRG15 complex with PALB2 peptide
8YAP Structure of human PALB2 coiled-coil domain

Browse structure collections

About this viewer

MolViewer shows 3EU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.